DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and Stag1

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_033308.2 Gene:Stag1 / 20842 MGIID:1098658 Length:1258 Species:Mus musculus

Alignment Length:1028 Identity:242/1029 (24%)
Similarity:446/1029 (43%) Gaps:165/1029 (16%)


  Fly    44 GDATNKSLLQMILSRKRLSPTNKRNSHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIP 108
            ||....:|.:::...|         |.::||...|.|.|......||:.|:.|.::.||....:.
Mouse    80 GDGDPVTLFEVVKLGK---------SAMQSVVDDWIELYKQDRDIALLDLINFFIQCSGCRGTVR 135

  Fly   109 DDTSMPFSYSDILSNSSSHF-SNTHIYPLI------RKPADVFVNQVGSFLNALL------LVAN 160
            .:.......::|:...:..| .::..|||.      :|    |.:....|:..|:      ::.:
Mouse   136 IEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKK----FRSNFCEFIGVLIRQCQYSIIYD 196

  Fly   161 KFRSDSYQLFLVQLTNFVMACSESNIRTFRHTATMIGLKIMTIL--------------------- 204
            ::..|:       :.:.:...|:|.:|.||||:|:..:|:||.|                     
Mouse   197 EYMMDT-------VISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAE 254

  Fly   205 --------------------SDLKSLDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQW 249
                                .:|:...|||. .:...:|..:||.|.||.:.:||.:||.|:|.|
Mouse   255 RNKMIGKRANERLELLLQKRKELQENQDEIE-NMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVW 318

  Fly   250 FARYPHCHLQPTSLRIFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELC 313
            ...|....|..:.|:.....|:|..|:| ::| |..:..|.....||.::...|:.|::.:|.:.
Mouse   319 MKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKC-LKALQSLYTNRELFPKLELFTNRFKDRIVSMT 382

  Fly   314 LGKEDAIAEKSVQFLTHFHVLSAEILTDDVCRVLEQLIMAANRGLAQAAADLFILR--------- 369
            |.||..:|.::::.:|.....|.|.|:::.|..:..|:.:|:|.:|.||.:....:         
Mouse   383 LDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLVYSAHRPVAVAAGEFLHKKLFSRHDPQA 447

  Fly   370 ---------RNGLDGETFCQRVKHLLQLFIECG-HEQADYLVDSLIDNC-ELVLDWKSMIAVLLE 423
                     ||..:|..    ::.|:..|:|.. ||.|.||||||.::. ||:.||:.|..:|||
Mouse   448 EEALAKRRGRNSPNGNL----IRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLE 508

  Fly   424 NPKSRE--LSDIHCSSLIAILLAGVKQATAGEIPPGRYT-----KDLKREPRQGAQERATKCLAP 481
            .|...|  :||...|:||.:::..::||.....|.||.|     ...:|:.:...:.:.|:....
Mouse   509 EPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFII 573

  Fly   482 VLPELLRTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITV 546
            .||.||..|:...:.:..||::|:||..:.|........|:.|::..:.:: ::...:.||:...
Mouse   574 TLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVV-EKHVESDVLEACS 637

  Fly   547 KTLEFL--------NRMIPIPLTK-QLLNSAVTNYKMAWHRTQD--TSPSRSTHNESNRLLATLR 600
            ||...|        ||   :.:.: ||::..|..:.   |..:|  .....:..::...:|:||:
Mouse   638 KTYSILCSEEYTIQNR---VDIARSQLIDEFVDRFN---HSVEDLLQEGEEADDDDIYNVLSTLK 696

  Fly   601 LLTVLSGHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFC---CLCWDMENL 662
            .||......:|:||||.......||..:....:|.         .:.::|..|   .:.|.:..:
Mouse   697 RLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPE---------QIVVQALQCSHYSILWQLVKI 752

  Fly   663 EGTALNNVDMDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTCDLFVL--HGNLCGSSN 725
            ...:.:..|:    .||...::.:|.|....:...|| |:....|...|||.::  |..:.|...
Mouse   753 TDGSPSKEDL----LVLRKTVKSFLAVCQQCLSNVNT-PVKEQAFMLLCDLLMIFSHQLMTGGRE 812

  Fly   726 PSIRSVAHVPSGNELDILEGFLMEH-FLELSPSDLMLETNSDQ-------LQRIRSILTSYLKVV 782
            .....|.:..:|.:.::| .|:|:| |::....:..:|.:.:.       |.:.|::|.::.|::
Mouse   813 GLQPLVFNPDTGLQSELL-SFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLI 876

  Fly   783 CLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDTRH 847
            ...:|....|:..:::|:||:..:||:::.::....|.:.|..|.|:    :|...::|.:..:.
Mouse   877 IYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQIDKIQCAKTL----ILSLQQLFNELVQE 937

  Fly   848 AAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELA-QKQPTEATKKLP 911
            .........|..|.:.|||.|.|.....:.::.||.|..||:.||.|.|:.. ||........|.
Mouse   938 QGPNLDRTSAHVSGIKELARRFALTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLA 1002

  Fly   912 FLRVLKVFVPLLLVQDKTRILNFFEPY--EQLIIPTCNRNDI-AHLKEYRNAL 961
            ||.||..|...||.|||..:.::.|.:  ||::.   .|.|: ..|..|||:|
Mouse  1003 FLEVLSEFSSKLLRQDKKTVHSYLEKFLTEQMME---RREDVWLPLISYRNSL 1052

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 24/136 (18%)
Stag1NP_033308.2 RFX5_DNA_bdg 3..>58 CDD:291295
IRR1 12..>398 CDD:227824 74/340 (22%)
STAG 160..268 CDD:285686 20/119 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62873128
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.