DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and scc-3

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_506193.1 Gene:scc-3 / 179749 WormBaseID:WBGene00004738 Length:1096 Species:Caenorhabditis elegans

Alignment Length:1034 Identity:235/1035 (23%)
Similarity:423/1035 (41%) Gaps:212/1035 (20%)


  Fly    45 DATNKSLLQMILSRKRLSPTNKRNSHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIPD 109
            :..::.|:..:.|.|:::         |:|.::.|. |.:....|:..:.||...:.|....:..
 Worm   106 EVDDRELVAAVKSGKKIT---------EAVDRWIGR-YNEKFLVAIAEMHQFFFAICGCKGIVTP 160

  Fly   110 DTSMPFSYSDILSNSSSHF-SNTHIYPLIRKPA--DVFVNQVGSFLNALLLVANKFRSDSYQLF- 170
            ..|...:|.||:...:..| .::..|||:...:  .|..| :.:|::.|::     |:.:..|| 
 Worm   161 QMSATLTYKDIICRMTEDFEEDSADYPLVHGGSLKKVRAN-LHNFIHTLII-----RTKASMLFD 219

  Fly   171 ------LVQLTNFVMACSESNIRTFRHTATMIGLKIMTILSDL------------KSLD------ 211
                  .|||   :...::|.:|.||||||...:||.:.|.|:            |.::      
 Worm   220 SNLMDGFVQL---LTGMADSQVRAFRHTATFCAMKITSALVDVTIELTQSKEKTSKQIEAEKAKL 281

  Fly   212 ------------------------DEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFAR 252
                                    :||...:. .:|.|:||.|.||:|.|||.:||.|||.|...
 Worm   282 KNNSAGNEKYEALVAQRTQTEERAEEIRQIIG-YLFRSVFVHRYRDVVPDIRCICIQELGHWMDV 345

  Fly   253 YPHCHLQPTSLRIFYEALNDGSGDVIQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKE 317
            ||...::.:.|:....::.|..|||.|..:..:..|..|.::..::....::|::.||.:.|.|:
 Worm   346 YPEHFVEDSYLKYIGWSMFDKVGDVRQRCIRALIPLFEKTLILDKLELFVNKFKDRLVSMLLDKD 410

  Fly   318 DAIAEKSVQFLTHFHVLSAEILT-DDVCRVLEQLIMAANRGLAQAAADLF----ILRRNGLDGE- 376
            ...:.::|..:...:.:...:|| .||..:.| ||.|:||.|| .||.:|    :.|.....|: 
 Worm   411 LETSIETVHLMRVLYTVFPTLLTIKDVVPIYE-LIYASNRPLA-VAAGMFLNTKVFRSAEKPGKA 473

  Fly   377 ---TFCQRVKHLLQLFIECG-HEQADYLVDSLIDNCELVLDWKSMIAVLLENPKSRELSDIHCSS 437
               .....||.|...|||.. |:.|.||||:|.::..:|.||.:|..:|:.:  ..:|.....:.
 Worm   474 PTAANIPLVKDLTTFFIEGDLHQHATYLVDALFESNPIVKDWATMGELLIND--QYQLDSNFETK 536

  Fly   438 LIAILLAGVKQATAGEIPPGRY-----------TKDLKREPRQGAQERATKCLAPVLPELLRTYA 491
            ||.||...|.|:..||.|.||:           ::||..:     ::|.|:.|.|::|.|:..::
 Worm   537 LIEILTCSVVQSATGEPPVGRHIVKKGAPSAKESRDLVED-----RQRLTETLIPLIPRLITKFS 596

  Fly   492 NRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLEFLNRMI 556
            :..:.|..|:.:|.:|..:.|........|.||:|..:.:| ::.....:|:...:....|.   
 Worm   597 SDNEKIINLVNIPLHFQLETYLSARMQTHLMELMEGLDSLI-EKHLDEELLKAVAELYYHLT--- 657

  Fly   557 PIPLTKQLLNSAVTNYKM-------AWHR--TQDTSPSRSTHNESNRLLATLRLLTVLSGHFNLS 612
                |...:::.|..:||       |:.|  .|.....:....|....::.::.:...:|..:|.
 Worm   658 ----TNSSISALVEGHKMKLLDGVAAFIRKSMQQFDDDQMGEEEEALFVSYIKRMAAFAGFMDLR 718

  Fly   613 KWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFCCLCWDMENL--EG----------- 664
            .|||.:.|   ||::....|    :|...:.....::..|..||:|..|:  ||           
 Worm   719 HWDLWDIL---LKVVSNYTR----EDTQRDVRERSMQMLFMQLCFDSMNIKKEGETPKADQVRKL 776

  Fly   665 ------------TALNNVDMDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTCDLFVLH 717
                        ..||    :|.|.|    .:.||.:                     |||.:|.
 Worm   777 KKRRDQLIRIVTETLN----EEACGV----EQAYLVI---------------------CDLMILF 812

  Fly   718 GNLCGSSNPSIRSVAHVPSGNELDILEGFLMEHFLELSPSDLMLETNSDQLQRI------RSILT 776
            |:.....:.::..:...|....|..|:.||..:..::|..|.|     ||.::|      |..:.
 Worm   813 GSQLAEESKALEPLIWRPDAMVLGNLKIFLDVNVFDVSNLDDM-----DQQEKIEVMHKMRQHVA 872

  Fly   777 SYLKVVCLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVF 841
            .|.|::..|.:|...||...:.|..:...|||:.:..:....:.:.:...:.:..|...||:::.
 Worm   873 QYAKLIIHGAMPVAEASHLIKRYQSHFQDFGDIFKNLLSKCREISFVETGVMICETLKTLYSQLD 937

  Fly   842 PDDTRHAAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTEA 906
            .|.......:      .|:.:.:||.||......:..::|..:.:||:..|.|.||...|:..:.
 Worm   938 EDQGTDPLSE------SFNSIRDLAKRLGPAFGVDYAKNRFAISSLHKKAIDFAFEEYDKENHQM 996

  Fly   907 TKKLPFLRVLKVFVPLLLVQDKTRILNF---------------FEPYEQLIIPTCNRND 950
            .|.:.||.:...|...||.|||..::.:               :|||...:....:|||
 Worm   997 PKNIFFLEIAIEFSGKLLAQDKMAVVRYLNKIYTNRVGTSTVVWEPYRLYLGSLSDRND 1055

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 28/134 (21%)
scc-3NP_506193.1 STAG 184..286 CDD:285686 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C59626429
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.810

Return to query results.
Submit another query.