DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and Stag3

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_446182.1 Gene:Stag3 / 114522 RGDID:621333 Length:1256 Species:Rattus norvegicus

Alignment Length:1066 Identity:250/1067 (23%)
Similarity:440/1067 (41%) Gaps:216/1067 (20%)


  Fly    12 NDSQASNQMDFE------IREECS--------IA--PNDEPVCVDGTVGDATNKSLLQMILSRKR 60
            :.|..|...|||      :|:..:        :|  |..:...|.|  |:..|||          
  Rat    56 DSSSTSEDSDFEDSLRRNVRKRAAKRPPKAIPVAKHPKKQSHIVPG--GNDKNKS---------- 108

  Fly    61 LSPTN-------KRNSHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIPDDTSMPFSYS 118
            :.||:       ...|..:|:...|.|.|.....|..:.|:.|.:...|....:..:.....|.|
  Rat   109 VPPTSDLFDAVKAARSCAQSLVDEWLENYKQDENAGFLELVNFFIRACGCKSTVTPEMFKTMSNS 173

  Fly   119 DILSNSSSHFS-NTHIYPLIRKPADVFVNQVGS---FLNALL------LVANKFRSDSYQLFLVQ 173
            :|:.:.:..|: ::..||| ..|...:....||   |:..|:      |:.:.|..|       .
  Rat   174 EIIQHLTEEFNEDSGDYPL-TAPGPSWKKFQGSFCEFVKTLVCQCQYSLLFDGFPMD-------D 230

  Fly   174 LTNFVMACSESNIRTFRHTATMIGLKIMTIL-------------------------------SDL 207
            |.:.::..|:|.:|.||||:|:..:|:||.|                               ..|
  Rat   231 LISLLIGLSDSQVRAFRHTSTLAAMKLMTSLVKVALQLSLHKDNNQRQYEAERNKGPEQRAPERL 295

  Fly   208 KSL---------DDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFARYPHCHLQPTSL 263
            :||         :.|....:...:|..:||.|.|||:.:||.:||.|:|.|...|....|..:.|
  Rat   296 ESLLEKRKEFQENQEEIEGMMNAIFRGVFVHRYRDILPEIRAVCIEEIGCWMQSYSTSFLNDSYL 360

  Fly   264 RIFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKEDAIAEKSVQF 327
            :.....|:|...:| ::| :..::.|.....|.|.:...|:.|::.:|.:.:.:|..:|.::::.
  Rat   361 KYIGWTLHDKHKEVRLKC-VKALAGLYSNQELSSRMELFTNRFKDRMVSMVMDRESEVAVEAIRL 424

  Fly   328 LTHFHVLSAEILTDDVCRVLEQLIMAANRGLAQAAADLFIL------------------RRNGLD 374
            ||........:||...|..:..::..:||.:|.:|.: |:.                  ||:...
  Rat   425 LTLILKNMEGVLTSADCEKIYSIVYISNRAMASSAGE-FVYWKIFHPECGAKAVSGRERRRSPQA 488

  Fly   375 GETFCQRVKHLLQLFIEC-GHEQADYLVDSLIDNC--ELVLDWKSMIAVLLENPKSRELSDIHCS 436
            ..||   :..||..|:|. .|:.|.||||||.| |  ..:.||:|:.::||:  |.:.|.|:...
  Rat   489 QRTF---IYLLLAFFMESEHHDHAAYLVDSLWD-CAGSYLKDWESLTSLLLQ--KDQNLGDMQER 547

  Fly   437 SLIAILLAGVKQATAGEIPPGRYT--KDL-KREPRQGAQERA--TKCLAPVLPELLRTYANRLQD 496
            .||.||::..:||..|..|.||.|  |.| .:|.:..|.::.  .:.|.|:||:||..::...::
  Rat   548 MLIEILVSSARQAAEGHPPVGRITGKKSLTAKERKLQAYDKVKLAEHLIPLLPQLLAKFSADAEN 612

  Fly   497 IERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLE----------- 550
            :..||.|..||..:.|..|       .|.:|.||:: .|.....|..:..:.||           
  Rat   613 VAPLLRLLSYFDLNIYCTQ-------RLEKHLELLL-QQLQEVVVKHVEPEVLEAAAHALYLLCK 669

  Fly   551 ----FLNRMIPIPLTKQLLNSAVTNYKMAWHRTQD-----TSPSRSTHNESNRLLATLRLLTVLS 606
                |.:|   :...:..|...:|:      |.|.     ...|....:|...|.|||:.|:...
  Rat   670 PEFTFFSR---VDFARSQLVDLLTD------RFQQELDDLMQSSFLDEDEVYSLTATLKRLSAFY 725

  Fly   607 GHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFCCLCWDMENL-EGTALNNV 670
            ...:|::|:::||....|:..:....:|:...||.      |...:..:.|.:.:: |.|:...:
  Rat   726 NAHDLTRWEISEPCSRLLRKAVDTGEVPHQVILPA------LTLVYFSILWTVTHISESTSQKQL 784

  Fly   671 -----DMDEYCDVLHHNLEDYLYVTFSLVGKSNTEP-LAYPCFSYTCDLFVLHG-NLCGSSNPSI 728
                 .|..:|::....|.|             .:| :....|....||.::.. .:.......:
  Rat   785 MSLKKRMVAFCELCQSCLSD-------------VDPEIQEQAFVLLSDLLLIFSPQMVVGGRDFL 836

  Fly   729 RSVAHVPSGNELDILEGFLMEHFLELSPSDL-MLETNSDQLQ-----RIRSILTSYLKVVCLGVV 787
            |.:...|.......|..|||:|.. |.|.:| ..::..|.:|     :.|.:|..:.|::..||:
  Rat   837 RPLVFFPEATLQSELASFLMDHVF-LQPGELGNGQSQEDHVQIELLHQRRRLLAGFCKLLLYGVL 900

  Fly   788 PTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVF----PDDTRHA 848
            ....||..:::|.|::..:||:::.::..|.|.:....:..:|.:...||.::.    |.|....
  Rat   901 ELDAASDVFKHYNKFYEDYGDIIKETLTRARQIDRCQCSRILLLSLKQLYTELIQEQGPQDLTEL 965

  Fly   849 AGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTEATKKLP-- 911
                   || |.|:.:||.|.|.......:.:|:.|:.||:.||  .|.|::..|..::::.|  
  Rat   966 -------PA-FIEMRDLARRFALSFGPQQLHNRDLVVMLHKEGI--KFSLSELPPAGSSREPPNI 1020

  Fly   912 -FLRVLKVFVPLLLVQDKTRILNFFE 936
             ||.:|..|.|.|..|||..:|::.|
  Rat  1021 AFLELLSEFSPRLFHQDKQLLLSYLE 1046

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 28/132 (21%)
Stag3NP_446182.1 STAG 188..296 CDD:285686 25/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62855452
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.957 Consistency score
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.