DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and STAG2

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001036214.1 Gene:STAG2 / 10735 HGNCID:11355 Length:1268 Species:Homo sapiens

Alignment Length:1096 Identity:270/1097 (25%)
Similarity:468/1097 (43%) Gaps:190/1097 (17%)


  Fly     3 DISFDDAVLNDSQA--SNQMDFEIREECSIAPNDEPVCVDGTVGDAT-----NKSLLQMILSRKR 60
            :|..|..:|.:|:.  |:..|||..|..:........|..|..|.|.     |.       ..|.
Human     6 EIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNG-------GGKP 63

  Fly    61 LSPTNKRNSH---------------------IESVAKYWGEFYLDSPTAALVALLQFVVEVSGSH 104
            .|..|:.|.|                     ::||...|.|.|......||:.|:.|.::.||..
Human    64 PSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINFFIQCSGCK 128

  Fly   105 YQIPDDTSMPFSYSDILSNSSSHF-SNTHIYPLI------RKPADVFVNQVGSFLNALLLVANKF 162
            ..:..:.......|:|:...:..| .::..|||.      :|....|...:|      :||....
Human   129 GVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG------VLVRQCQ 187

  Fly   163 RSDSYQLFLVQ-LTNFVMACSESNIRTFRHTATMIGLKIMTIL---------------------- 204
            .|..|..:::. :.:.:...|:|.:|.||||:|:..:|:||.|                      
Human   188 YSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSINMDNTQRQYEAER 252

  Fly   205 -------------------SDLKSLDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWF 250
                               .:|:...|||. .:...:|..:||.|.||.:.:||.:||.|:|.|.
Human   253 NKMIGKRANERLELLLQKRKELQENQDEIE-NMMNAIFKGVFVHRYRDAIAEIRAICIEEIGIWM 316

  Fly   251 ARYPHCHLQPTSLRIFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCL 314
            ..|....|..:.|:.....::|..|:| ::| |..:..|.....|.|::...||.|::.:|.:.|
Human   317 KMYSDAFLNDSYLKYVGWTMHDKQGEVRLKC-LTALQGLYYNKELNSKLELFTSRFKDRIVSMTL 380

  Fly   315 GKEDAIAEKSVQFLTHFHVLSAEILTDDVCRVLEQLIMAANRGLAQAAAD-----LF-------- 366
            .||..:|.::::.||.....|.|:||.:.|..:..|:.:|:|.:|.||.:     ||        
Human   381 DKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSAHRPVAVAAGEFLYKKLFSRRDPEED 445

  Fly   367 -ILRRNGLDGETFCQRVKHLLQLFIECG-HEQADYLVDSLIDNC--ELVLDWKSMIAVLLENPKS 427
             :::|.|..|.. ...||.|:..|:|.. ||.|.|||||:.| |  ||:.||:.|.::|||.|.|
Human   446 GMMKRRGRQGPN-ANLVKTLVFFFLESELHEHAAYLVDSMWD-CATELLKDWECMNSLLLEEPLS 508

  Fly   428 RE--LSDIHCSSLIAILLAGVKQATAGEIPPGRYTKD---LKREPRQGAQERA--TKCLAPVLPE 485
            .|  |:|...|:||.|:|..::||.....|.||.|..   ..:|.:....:|.  |:..|..||:
Human   509 GEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDRTKITELFAVALPQ 573

  Fly   486 LLRTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLE 550
            ||..|:...:.:..||:||:||..:.|........|:.|:.....|: ::.:.|.||:...||..
Human   574 LLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIV-EKHTDTDVLEACSKTYH 637

  Fly   551 FL--------NRMIPIPLTK-QLLNSAVTNYKMAWHRTQD--TSPSRSTHNESNRLLATLRLLTV 604
            .|        ||   :.::: ||::.....:.   ...:|  ........:::.::|:||:.:|.
Human   638 ALCNEEFTIFNR---VDISRSQLIDELADKFN---RLLEDFLQEGEEPDEDDAYQVLSTLKRITA 696

  Fly   605 LSGHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKAC-FCCLCWDMENLEGTALN 668
            .....:|||||     ||:....|.:..:.|||  .||...::...| ...:.|.:..:..::..
Human   697 FHNAHDLSKWD-----LFACNYKLLKTGIENGD--MPEQIVIHALQCTHYVILWQLAKITESSST 754

  Fly   669 NVD-------MDEYCDVLHHNLEDYLYVTFSLVGKSNTEPLAYPCFSYTCDLFVLHGN-LCGSSN 725
            ..|       |..:|.:..|      |:|     ..|| .:....|:..||:.::..: :.....
Human   755 KEDLLRLKKQMRVFCQICQH------YLT-----NVNT-TVKEQAFTILCDILMIFSHQIMSGGR 807

  Fly   726 PSIRSVAHVPSGNELDILEGFLMEH-FLEL----SPSDLMLETNSDQLQRI---RSILTSYLKVV 782
            ..:..:.:.|..:....|..|:::| |:|.    :.:|...|..:.:::.:   |::|.::.|::
Human   808 DMLEPLVYTPDSSLQSELLSFILDHVFIEQDDDNNSADGQQEDEASKIEALHKRRNLLAAFCKLI 872

  Fly   783 CLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDTRH 847
            ...||....|:..::.|:||:..:||:::.:|....|.:.|..|.|::.:...|:.::..::   
Human   873 VYTVVEMNTAADIFKQYMKYYNDYGDIIKETMSKTRQIDKIQCAKTLILSLQQLFNEMIQEN--- 934

  Fly   848 AAGQRALRPAE-FSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTEATKKLP 911
              |....|.:. ||.:.|||.|.|.....:.::.||.:..||:.||.|.|    |:|....:..|
Human   935 --GYNFDRSSSTFSGIKELARRFALTFGLDQLKTREAIAMLHKDGIEFAF----KEPNPQGESHP 993

  Fly   912 -----FLRVLKVFVPLLLVQDKTRILNFFEPYEQLIIPTCNRNDI-AHLKEYRNAL 961
                 ||.:|..|...||.|||..:..:.|.:....: :..|.|: ..|..|||:|
Human   994 PLNLAFLDILSEFSSKLLRQDKRTVYVYLEKFMTFQM-SLRREDVWLPLMSYRNSL 1048

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 26/131 (20%)
STAG2NP_001036214.1 STAG 157..265 CDD:312124 22/114 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62897033
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11199
Phylome 1 0.910 0.957 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.810

Return to query results.
Submit another query.