DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and LOC102553065

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_006257787.2 Gene:LOC102553065 / 102553065 RGDID:7729409 Length:426 Species:Rattus norvegicus

Alignment Length:449 Identity:96/450 (21%)
Similarity:179/450 (40%) Gaps:83/450 (18%)


  Fly   479 LAPVLPELLRTYANRLQDIERLLELPKYFCFDYYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQ 543
            |.|:||:||..::...:::..||.|..||..:.|..|       .|.:|.||:: .|.....|..
  Rat    23 LIPLLPQLLAKFSADAENVAPLLRLLSYFDLNIYCTQ-------RLEKHLELLL-QQLQEVVVKH 79

  Fly   544 ITVKTLE---------------FLNRMIPIPLTKQLLNSAVTNYKMAWHRTQD-----TSPSRST 588
            :..:.||               |.:|   :...:..|...:|:      |.|.     ...|...
  Rat    80 VEPEVLEAAAHALYLLCKPEFTFFSR---VDFARSQLVDLLTD------RFQQELDDLMQSSFLD 135

  Fly   589 HNESNRLLATLRLLTVLSGHFNLSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFC 653
            .:|...|.|||:.|:......:|::|:::||....|:..:....:|:...||.      |...:.
  Rat   136 EDEVYSLTATLKRLSAFYNAHDLTRWEISEPCSRLLRKAVDTGEVPHQVILPA------LTLVYF 194

  Fly   654 CLCWDMENL-EGTALNNV-----DMDEYCDVLHHNLEDYLYVTFSLVGKSNTEP-LAYPCFSYTC 711
            .:.|.:.:: |.|:...:     .|..:|::....|.|             .:| :....|....
  Rat   195 SILWTVTHISESTSQKQLMSLKKRMVAFCELCQSCLSD-------------VDPEIQEQAFVLLS 246

  Fly   712 DLFVLHG-NLCGSSNPSIRSVAHVPSGNELDILEGFLMEHFLELSPSDL-MLETNSDQLQ----- 769
            ||.::.. .:.......:|.:...|.......|..|||:|.. |.|.:| ..::..|.:|     
  Rat   247 DLLLIFSPQMVVGGRDFLRPLVFFPEATLQSELASFLMDHVF-LQPGELGNGQSQEDHVQIELLH 310

  Fly   770 RIRSILTSYLKVVCLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCL 834
            :.|.:|..:.|::..||:....||..:::|.|::..:||:::.::..|.|.:....:..:|.:..
  Rat   311 QRRRLLAGFCKLLLYGVLELDAASDVFKHYNKFYEDYGDIIKETLTRARQIDRCQCSRILLLSLK 375

  Fly   835 LLYAKVF----PDDTRHAAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHR 889
            .||.::.    |.|....       || |.|:.:||.|.|.......:.:|:.|:.||:
  Rat   376 QLYTELIQEQGPQDLTEL-------PA-FIEMRDLARRFALSFGPQQLHNRDLVVMLHK 426

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686
LOC102553065XP_006257787.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.