DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and LOC100333021

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:XP_009305909.3 Gene:LOC100333021 / 100333021 -ID:- Length:1105 Species:Danio rerio

Alignment Length:1062 Identity:254/1063 (24%)
Similarity:433/1063 (41%) Gaps:243/1063 (23%)


  Fly    12 NDSQASNQMDFEIREECSIAPNDEPVCVDGTVGDAT----NKSLLQMILSRKRLSPTNKR----- 67
            :||.:....|||.:.:.|...      |:.|.|.|:    ::.....:.|.:..:||:..     
Zfish     9 DDSISLTGSDFEFQLKTSKRK------VNSTQGVASPNRVHRRPASALSSSQSQAPTDSEGGVST 67

  Fly    68 ----------NSHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIPDDTSMPFSYSDILS 122
                      .|.:.:|...|.|.|.....|.|:.|:.|||:.||....:..:.......:||:|
Zfish    68 AYLYEAVRSGRSALTTVIDDWLEEYQRDKEAGLLELINFVVQCSGCKGVVSREMLSSLQNADIIS 132

  Fly   123 NSSSHFSNTHI-YPLI------RKPADVFVNQVGSFLNALL------LVANKFRSDSYQLFLVQL 174
            :.:..|:...: |||:      |:    |...|..|:..|:      |:.:.|...|   |:..|
Zfish   133 HLTKEFNEDSVSYPLVSSGPQWRR----FSEGVCEFVCVLVRGCRNTLLYDDFLFSS---FIALL 190

  Fly   175 TNFVMACSESNIRTFRHTATMIGLKIMTIL-----------------SDL--------KSLD--- 211
            |..    ::|.:|.||||::.|.:::|:.:                 |||        :::|   
Zfish   191 TGL----ADSQVRAFRHTSSFIAMRLMSSIVSVAADVNIQAQMIQRRSDLEKSKPAEERAIDRLE 251

  Fly   212 ------------DEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFARYPHCHLQPTSLR 264
                        .|...::...:|..:||.|.||::.:||.:|:.|:|.|....|...|....|:
Zfish   252 ELEHSYRELMEQQEDLRSLMNGIFKGVFVHRYRDVIPEIRAVCMEEMGVWLRENPAHFLNDEHLK 316

  Fly   265 IFYEALNDGSGDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKEDAIAEKSVQFL 328
            .....|:|....| :||.|....:...||.| |.:...||.|:|.::.:.|.|:..:|.::|:.|
Zfish   317 YVGWMLHDKQAAVRLQCVLTLQKLFEEKDFL-SRLEFFTSRFKERILCMILDKDSDVAVETVKLL 380

  Fly   329 THFHVLSAEILTDDVCRVLEQ-----LIMAANRGLAQAAADLFILRRNGLDGETFC--------Q 380
                 |..:..|||.....|:     |:.|.:|||| .||..|:.       .|.|        .
Zfish   381 -----LLIQTQTDDGLSASERAAVYPLVFATHRGLA-CAAGRFLY-------HTLCCAADQSSDS 432

  Fly   381 RVKHLLQL----FIECG-HEQADYLVDSLID--NCELVLDWKSMIAVLLENPKSRELSDIHCSSL 438
            |...:|:|    ||:.. |:.|.||||||.|  ..|| .||:.|.::||::...:|..:   |:|
Zfish   433 RSVSILRLLALFFIQSEYHDHAAYLVDSLWDVAGAEL-KDWELMTSLLLQDSSLQEQLE---SAL 493

  Fly   439 IAILLAGVKQATAGEIPPGR-YTKDL-KREPRQGAQE--RATKCLAPVLPELLRTYANRLQDIER 499
            |.|::..|:||.....|..| :.|.: .|:.|..||:  |.:....||||:||..::..:..:.|
Zfish   494 IDIMMCAVRQAAEATPPTARAHRKSVTARQKRVQAQDQRRISSVFMPVLPQLLAKFSADVGKVSR 558

  Fly   500 LLELPKYFCFDYYHEQNRMGQ-LNELVEHFELIIFDQTSSTTVLQITVK-----TLEFLNRMIPI 558
            ||..|.:|..:.|....|:.: |::|:             :.|..||:|     .||...|::.:
Zfish   559 LLRAPLHFQLEVYGTSGRLEKSLDQLL-------------SQVCDITLKHHEECVLEACVRVLCV 610

  Fly   559 PLTK-------------QLLNSAVTNYKMAWHRTQDTSPSRSTHNESNRLLATLRLLTVLSGHFN 610
            ..::             |||::.|..:..   ..::.....:..::..|..::|.:|.:.|    
Zfish   611 LCSEGYTFCGRAETAVGQLLDTTVEKFTA---NLEEILQGSADEDDLYRAASSLNILAIFS---- 668

  Fly   611 LSKWDLTEPLLFSLKMLLRQRRLPNGDDLPPEAFSLYLKACFCC---LCWDMENLEGTALNNVDM 672
             |..||||..||.....|.:..:..|:    .:..|.:.|..||   |.|..........:..:.
Zfish   669 -SARDLTERNLFEFCFQLLKMGVETGE----ISEKLMVPALSCCAYQLLWSAHRNTQRRTDKAEA 728

  Fly   673 DEYCDVLHHNLEDYLYVTFSLVGKS----NTEPLAYPCFSYTCDLFVLHGNLC----GSSNPSIR 729
            ......||         :|.::.:|    ...|:....|...|||.::   .|    ||.:|   
Zfish   729 RRVLKSLH---------SFCVLCQSCLSIALSPVRSKAFVCVCDLLLV---FCRPPEGSISP--- 778

  Fly   730 SVAHVPSGNELDILEGFLMEHFLELSPSDLMLE--------TNSDQ------LQRIRSILTSYLK 780
                         |:.|..:..|....:..:|:        |..|:      ||: |:.|:.|.|
Zfish   779 -------------LQRFSPDESLRAEMASFVLDYVFGDEDLTGEDEEMMTALLQK-RNHLSGYCK 829

  Fly   781 VVCLGVVPTMRASKFYEYYVKYHAPFGDVMRCSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDT 845
            ::..||:....|:....||.:::..|||:::.::..:...|....|.|:......|||.:   |.
Zfish   830 LIIYGVLELQAATDILRYYHRFYKDFGDIIKETLNKSKMINSEDSARTVCLCLQQLYAGL---DL 891

  Fly   846 RHAAGQRALRPAEFSELMELANRLAKILISNPMEHRECVIALHRSGILFVFELAQKQPTEATKKL 910
            :...|       |..|:..||.:||.....|....|:.:::||:.||.|..:..:|  .|| ..|
Zfish   892 QCCDG-------ELMEIRLLAKKLAMNFSINLRLVRKPLLSLHQDGIRFASQGLEK--GEA-MNL 946

  Fly   911 PFLRVLKVFVPLLLVQDKTRIL 932
            .||.:|..|...||..::.::|
Zfish   947 QFLEILSEFSFKLLQPERKQLL 968

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 27/135 (20%)
LOC100333021XP_009305909.3 STAG 143..240 CDD:312124 25/108 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.