DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SA-2 and stag1

DIOPT Version :8

Sequence 1:NP_612109.3 Gene:SA-2 / 38167 FlyBaseID:FBgn0043865 Length:973 Species:Drosophila melanogaster
Sequence 2:NP_001121432.1 Gene:stag1 / 100158523 -ID:- Length:1265 Species:Xenopus tropicalis

Alignment Length:999 Identity:237/1000 (24%)
Similarity:434/1000 (43%) Gaps:148/1000 (15%)


  Fly    69 SHIESVAKYWGEFYLDSPTAALVALLQFVVEVSGSHYQIPDDTSMPFSYSDILSNSSSHF-SNTH 132
            |.::||...|.|.|......||:.|:.|.::.||....:..:.......::|:...:..| .::.
 Frog   103 SAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCKGTVRIEMFRNMQNAEIIRKMTEEFDEDSG 167

  Fly   133 IYPLI------RKPADVFVNQVGSFLNALL------LVANKFRSDSYQLFLVQLTNFVMACSESN 185
            .|||.      :|    |......|::.|:      ::.:::..|:       :.:.:...|:|.
 Frog   168 DYPLTMPGPHWKK----FRCNFCEFISVLIRQCQYSIIYDEYMMDT-------VISLLTGLSDSQ 221

  Fly   186 IRTFRHTATMIGLKIMTIL-----------------------------------------SDLKS 209
            :|.||||:|:..:|:||.|                                         .:|:.
 Frog   222 VRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQE 286

  Fly   210 LDDEIAMTVWMQMFNSMFVARSRDIVTDIRLLCISELGQWFARYPHCHLQPTSLRIFYEALNDGS 274
            ..|||. .:...:|..:||.|.||.:.:||.:||.|:|.|...|....|..:.|:.....|:|..
 Frog   287 NQDEIE-NMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQ 350

  Fly   275 GDV-IQCSLDNISVLCRKDVLFSEIVALTSEFREILVELCLGKEDAIAEKSVQFLTHFHVLSAEI 338
            |:| ::| |..:..|.....||.::...|:.|::.:|.:.|.||..:|.::::.:|.....|.|.
 Frog   351 GEVRLKC-LKALQSLYTNRELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEA 414

  Fly   339 LTDDVCRVLEQLIMAANRGLAQAAADL----FILRRNGLDGETFCQR----------VKHLLQLF 389
            |:::.|..:..|:.:|:|.:|.||.:.    ...|.:....|...:|          ||.|:..|
 Frog   415 LSNEDCENVYHLVYSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRSSPNGNLVKMLVLFF 479

  Fly   390 IECG-HEQADYLVDSLIDNC-ELVLDWKSMIAVLLENPKSRE--LSDIHCSSLIAILLAGVKQAT 450
            :|.. ||.|.||||||.::. ||:.||:.|..:|:|.|...|  :|:...|:||.:::..::||.
 Frog   480 LESELHEHAAYLVDSLWESSQELLKDWECMTELLVEEPMQGEEVMSERQESALIELMVCTIRQAA 544

  Fly   451 AGEIPPGRYT-----KDLKREPRQGAQERATKCLAPVLPELLRTYANRLQDIERLLELPKYFCFD 510
            ....|.||.|     ...:|:.:...:.:.|:.....||.||..|:...:.:..||::|:||..:
 Frog   545 EAHPPVGRGTGKRVLTAKERKTQLDDKNKLTEHFIVALPVLLSKYSADAEKVANLLQIPQYFDLE 609

  Fly   511 YYHEQNRMGQLNELVEHFELIIFDQTSSTTVLQITVKTLEFL--------NRMIPIPLTKQLLNS 567
            .|........|:.|::....:: ::...:.||:...||...|        || :.| ...||::.
 Frog   610 LYSTGRMEKHLDSLLKQIRFVV-EKHIESDVLEACSKTYSILCSEEYTIQNR-VEI-AHSQLIDE 671

  Fly   568 AVTNYKMAWHRTQD--TSPSRSTHNESNRLLATLRLLTVLSGHFNLSKWDLTEPLLFSLKMLLRQ 630
            ....:.   |..::  .....:..:|...::|:|:.||......:|:||:    |..|...|||.
 Frog   672 LADRFS---HAVEELLQEAEEADEDEIYNVMASLKRLTCFHNAHDLTKWE----LFVSCYRLLRA 729

  Fly   631 RRLPNGDDLPPEAFSLYLKACFC---CLCWDMENL-EGTALNNVDMDEYCDVLHHNLEDYLYVTF 691
                 |.:.......:.::|..|   .:.|.:..: ||    |...:|.. .|...::.:|.|..
 Frog   730 -----GIEHEGMMEQIVVQALQCSHYSILWQLVKITEG----NPSKEEML-TLRKTVKTFLAVCQ 784

  Fly   692 SLVGKSNTEPLAYPCFSYTCDLFVL--HGNLCGSSNPSIRSVAHVPSGNELDILEGFLMEH-FLE 753
            ..: .|.|..:....|...|||.::  |....|.....:..|.:...|.:.::| .|:|:| |::
 Frog   785 QYL-SSVTTTVKEQAFMLLCDLLMIFSHQLTTGGRENLVLLVFNPDVGLQSELL-NFVMDHVFID 847

  Fly   754 LSPSDLMLETNSDQ-------LQRIRSILTSYLKVVCLGVVPTMRASKFYEYYVKYHAPFGDVMR 811
            ....:..:|.:.:.       |.:.|::|.::.|::...:|....|:..:::|:||:..:||:::
 Frog   848 QDDENQSMEGDEEDEANKIEALHKRRNLLAAFCKLIIYDIVDMHAAADIFKHYMKYYNDYGDIIK 912

  Fly   812 CSMELALQRNPIHFAMTMLHTCLLLYAKVFPDDTRHAAGQRALRPAEFSELMELANRLAKILISN 876
            .::....|.:.|..|.|:    :|...::|.:..:..........|..|.:.|||.|.|.....:
 Frog   913 ETLSKTRQMDKIQCAKTL----ILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFALTFGLD 973

  Fly   877 PMEHRECVIALHRSGILFVFELAQKQPTE-ATKKLPFLRVLKVFVPLLLVQDKTRILNFFEPY-- 938
            .::.||.|..||:.||.|.|:....:..| ....|.||.||..|...||.|||..:.::.|.:  
 Frog   974 QIKTREAVATLHKDGIEFAFKYQNPKGQEYPPLNLAFLEVLSEFSSKLLRQDKKTVHSYLEKFLT 1038

  Fly   939 EQLIIPTCNRNDI-AHLKEYRNAL 961
            :|::.   .|.|: ..|..|||:|
 Frog  1039 DQMME---RREDVWLPLISYRNSL 1059

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SA-2NP_612109.3 STAG 134..217 CDD:285686 24/136 (18%)
stag1NP_001121432.1 STAG 167..275 CDD:285686 20/119 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C62906701
eggNOG 1 0.900 E1_COG5537
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D167826at2759
OrthoFinder 1 1.000 FOG0000403
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.800

Return to query results.
Submit another query.