DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KIT and drpr

DIOPT Version :9

Sequence 1:	NP_001372213.1	Gene:	KIT / 3815	HGNCID:	6342	Length:	977	Species:	Homo sapiens
Sequence 2:	NP_001261276.1	Gene:	drpr / 38218	FlyBaseID:	FBgn0027594	Length:	1042	Species:	Drosophila melanogaster

Alignment Length:	178	Identity:	33/178 - (18%)
Similarity:	59/178 - (33%)	Gaps:	66/178 - (37%)

- Green bases have known domain annotations that are detailed below.

Human    43 KSDLIVRVGDEIRLLCTDPG-----FVKWTFEIL------DETNENKQNEWITEKAEATNTGKYT 96
            :|.:....||:    |...|     .:.:..::|      |.||....||.:.|:.....
  Fly   881 RSTMSTDYGDD----CNASGRVGSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDE----- 936

Human    97 CTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLR 161
            ..:|.|        .:||.|::  .:.|:.:::.|.|           :||......||
  Fly   937 IKHKEG--------YKDPVKIY--SKILFPEDEYDHL-----------DYSRPSTSQKP------ 974

Human   162 FIPDPKAGIMIKSVKRAYHRL---CLHCSVDQEGKSVLSEKFILKVRP 206
                            .|||:   .|:.:.|:|..|.:....:|..:|
  Fly   975 ----------------HYHRMNDAMLNINQDEEKPSNVKNMTVLLNKP 1006

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
KIT	NP_001372213.1	Ig strand A	212..215	CDD:409353
		ig	216..306	CDD:395002
		Ig strand B	229..239	CDD:409353
		Ig strand C'	250..252	CDD:409353
		Ig strand D	260..263	CDD:409353
		Ig strand E	267..280	CDD:409353
		Ig strand F	287..294	CDD:409353
		Ig strand G	300..308	CDD:409353
		IgI_4_SCFR	312..412	CDD:409446
		Ig strand B	332..336	CDD:409446
		Ig strand C	346..350	CDD:409446
		Ig strand E	376..380	CDD:409446
		Ig strand F	390..395	CDD:409446
		Ig strand G	403..406	CDD:409446
		Ig	427..503	CDD:409353
		Ig strand C	438..442	CDD:409353
		Ig strand E	471..479	CDD:409353
		Ig strand F	489..494	CDD:409353
		PTKc_Kit	554..929	CDD:270682
		Important for interaction with phosphotyrosine-binding proteins	569..571
drpr	NP_001261276.1	EMI	27..92	CDD:284877
		EGF_CA	274..319	CDD:304395
		DSL	<479..518	CDD:302925
		DSL	<567..606	CDD:302925
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0200
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900