DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KIT and drpr

Sequence 1:XP_005265797.1 Gene:KIT HGNCID:6342 Length:977 Species:Homo sapiens
Sequence 2:NP_001261276.1 Gene:drpr FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster

Alignment Length:209 Identity:38/210 (18%)
Similarity:72/210 (34%) Gaps:78/210 (37%)


Human    33 EPSPPSIHPGKS--DLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATN---- 91
            :.:|||..|..:  :.:..:..|.|||   |..::...     .|.::::...|:..:..|    
  Fly   841 DTNPPSWPPNHNFDNPVYGMQAETRLL---PNNMRSKM-----NNFDQRSTMSTDYGDDCNASGR 897

Human    92 TGKYTCTNKHGL---------SNSI---------YVF--------VRDPAKLFLVDRSLYGKEDN 130
            .|.|:....|.|         :|.|         :|:        .:||.|::  .:.|:.:::.
  Fly   898 VGSYSINYNHDLLTKNLNADRTNPIVYNESLKEEHVYDEIKHKEGYKDPVKIY--SKILFPEDEY 960

Human   131 DTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRL---CLHCSVDQEG 192
            |.|           :||......||                      .|||:   .|:.:.|:|.
  Fly   961 DHL-----------DYSRPSTSQKP----------------------HYHRMNDAMLNINQDEEK 992

Human   193 KSVLSEKFILKVRP 206
            .|.:....:|..:|
  Fly   993 PSNVKNMTVLLNKP 1006

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KITXP_005265797.1 ig 216..306 CDD:278476
IG_like 220..308 CDD:214653
Ig4_SCFR 312..412 CDD:143268
Ig 427..506 CDD:143165
PTKc_Kit 554..929 CDD:270682
Pkinase_Tyr 590..925 CDD:285015
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.