DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and PKT4

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_171965.1 Gene:PKT4 AraportID:AT1G04710 Length:443 Species:Arabidopsis thaliana

Alignment Length:406 Identity:162/407 (40%)
Similarity:230/407 (57%) Gaps:36/407 (9%)


  Fly     3 DVFIVSAARTPI-----GSFNGTL-SKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAG- 60
            ||.||:|.||.:     |||..|. .:|.||     |::.::.:.||...||.::::|..|..| 
plant    43 DVVIVAAQRTALCKAKRGSFKDTFPDELLAS-----VLRALIEKTNVNPSEVGDIVVGTVLGPGS 102

  Fly    61 QGQNPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVM 125
            |..:..|.|:..||.|..||...:|..|.|||:.||....||::|...|.:..|.|||:..|   
plant   103 QRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNP--- 164

  Fly   126 HLRQGVK--MGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEA 188
               :|.|  :.|........|:.|      :.||||:||:|.::|:|||.||..||.|..:|..|
plant   165 ---RGWKGSVNPNVKKFEQAHNCL------LPMGITSENVAHRFNVSREEQDQAAVDSHRKAASA 220

  Fly   189 QKKGYFDKEIVPVEIK-------DRKGTTTFSKDEYIKAGSTVEGIQKLRAAFKEGGSITAGNAS 246
            ...|.|..||.||:.|       |.| ..|.|.|:.|:..:|:.|:.||:..|||.|:.||||:|
plant   221 TASGKFKDEITPVKTKIVDPKTGDEK-PITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSS 284

  Fly   247 GVNDSAAAVLLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDL 311
            .::|.|.|||||......:|||..|.....::..|::|.:||:||..|:.|.::....:..:|||
plant   285 QLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDL 349

  Fly   312 YELNEAFAAQSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGG--RKGIA 374
            :|:|||||:|.:.....|.|||:|:||||||||:|||:||:|||.:.|||:.::|.|.  |.|:.
plant   350 FEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVV 414

  Fly   375 SLCIGGGMGIALAVER 390
            |:|||.|||.|...||
plant   415 SMCIGSGMGAAAVFER 430

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 162/407 (40%)
thiolase 5..390 CDD:238383 159/403 (39%)
PKT4NP_171965.1 PLN02287 1..443 CDD:215161 162/407 (40%)
thiolase 45..430 CDD:238383 159/403 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1129049at2759
OrthoInspector 1 1.000 T32372
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.