DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and ACAT2

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_568694.2 Gene:ACAT2 AraportID:AT5G48230 Length:403 Species:Arabidopsis thaliana

Alignment Length:393 Identity:179/394 (45%)
Similarity:248/394 (63%) Gaps:5/394 (1%)


  Fly     3 DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPAR 67
            ||.||..||||:|.|.|:||.|.|:.|||:.|...|:||||:...|.||:.|..|||..||.|||
plant    12 DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVLSANLGQAPAR 76

  Fly    68 QASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAP-HVMHLRQGV 131
            ||:|.||:|..|....:|.:|.||:|.|.:..|:|:.|...:|||||.||||..| ::...|:|.
plant    77 QAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKGS 141

  Fly   132 KMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDK 196
            :.|..::||.|:.|||.|...:..||..||..|:|:.|:||.||.|||.|..|...||:.|.|..
plant   142 RFGHDSLVDGMLKDGLWDVYNDCGMGSCAELCAEKFQITREQQDDYAVQSFERGIAAQEAGAFTW 206

  Fly   197 EIVPVEIKDRKG--TTTFSKDEYIKAGSTVEGIQKLRAAFKE-GGSITAGNASGVNDSAAAVLLM 258
            ||||||:...:|  :|...|||.:......: ::|||.:||| ||::||||||.::|.|||::|:
plant   207 EIVPVEVSGGRGRPSTIVDKDEGLGKFDAAK-LRKLRPSFKENGGTVTAGNASSISDGAAALVLV 270

  Fly   259 SGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSL 323
            |||:..:.||..||:|.|:..:..||:.....|..|:...:.....:..:||.||:|||||..:|
plant   271 SGEKALQLGLLVLAKIKGYGDAAQEPEFFTTAPALAIPKAIAHAGLESSQVDYYEINEAFAVVAL 335

  Fly   324 AVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAV 388
            |..:.|.:..:||||||||::||||:|.||||:|:|||..|::..|:.|:..:|.|||...||.:
plant   336 ANQKLLGIAPEKVNVNGGAVSLGHPLGCSGARILITLLGILKKRNGKYGVGGVCNGGGGASALVL 400

  Fly   389 ERL 391
            |.|
plant   401 ELL 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 178/392 (45%)
thiolase 5..390 CDD:238383 176/389 (45%)
ACAT2NP_568694.2 PLN02644 11..403 CDD:215347 178/392 (45%)
thiolase 15..383 CDD:238383 168/369 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 1 1.100 O PTHR18919
Phylome 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.