DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and zgc:123276

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001032498.1 Gene:zgc:123276 ZFINID:ZDB-GENE-051120-66 Length:396 Species:Danio rerio

Alignment Length:390 Identity:219/391 (56%)
Similarity:291/391 (74%) Gaps:2/391 (1%)


  Fly     3 DVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPAR 67
            ||:||:.||||||||.|.||||.||:||||.|.|.|:||:|:.:||:|||:||.|::..|.|.||
Zfish     6 DVYIVAGARTPIGSFMGCLSKLSASELGSVAIAEALKRADVKPEEVDEVIMGQILTSLCGANTAR 70

  Fly    68 QASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQGVK 132
            ||:.:.|:|..|||..:|.||.|||:.|.||.|||:.||::|||:||.||||.:||...||.|:|
Zfish    71 QAAYRTGIPFTVPAVQVNQLCASGLRAVVLGSQAIQCGDSKIVVSGGMESMSQSPHAAWLRPGIK 135

  Fly   133 MGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKE 197
            |...:..|:|:.|.|.|....|.||:||||:|.:..|||..||.:|..||.:.|...|||.|.:|
Zfish   136 MNDTSFQDTMMKDALNDPFFGISMGMTAENVAKQCGISRAEQDEFAACSQQKTETGVKKGVFKEE 200

  Fly   198 IVPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAFK-EG-GSITAGNASGVNDSAAAVLLMSG 260
            ||||.:.|||...|.::||:.::|:||:.:.|||..|: :| ||:||||:||:||.||||:|||.
Zfish   201 IVPVTVPDRKCPLTVTEDEFPRSGTTVQTLSKLRPCFETDGTGSVTAGNSSGINDGAAAVVLMSA 265

  Fly   261 EEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAV 325
            .||..:|::||.|||....|||:|::|||||:.||...|.|.:|..:.|||:|:||||||||:.|
Zfish   266 AEVVARGVEPLGRIVSHAMSGIDPRIMGLGPIEAVRKALLKADWTIDSVDLFEINEAFAAQSIGV 330

  Fly   326 LQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVER 390
            :::|:||..||||||||||||||:|:||||:||:|||||.:...::|:||||:|||||||:.|||
Zfish   331 IRELKLDLNKVNVNGGAIALGHPVGSSGARILVSLLYALRKMAKKRGVASLCVGGGMGIAICVER 395

  Fly   391  390
            Zfish   396  395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 219/391 (56%)
thiolase 5..390 CDD:238383 216/387 (56%)
zgc:123276NP_001032498.1 PRK05790 5..396 CDD:180261 219/391 (56%)
thiolase 8..395 CDD:238383 216/387 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.