DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and T02G5.7

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_495456.1 Gene:T02G5.7 WormBaseID:WBGene00020166 Length:390 Species:Caenorhabditis elegans

Alignment Length:396 Identity:151/397 (38%)
Similarity:228/397 (57%) Gaps:11/397 (3%)


  Fly     1 MSD--VFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQ 63
            |||  |||:|.||||||::.|:.:...|.:||:|..:..:.|:.|..:::.|||.|..|.||.||
 Worm     1 MSDKKVFILSGARTPIGAYRGSFANFGAVELGTVAAKAAIERSGVAPEKIEEVIGGCVLPAGLGQ 65

  Fly    64 NPARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLR 128
            |..||.||.||||:...|..:|.:|.|.:|.:......|::|....::..|.|:||..|..:. |
 Worm    66 NVTRQISLSAGLPVTTQAVTVNKVCSSSMKALVTAAVEIKAGYYDTILVVGTENMSQVPFYVP-R 129

  Fly   129 QGVKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGY 193
            ..:..|...|.|.:..|||.|..|...||:.||.....|.|:||.|||||:.|..:|..|.....
 Worm   130 GEIPFGGIQMTDGISKDGLEDIKEKGPMGLCAEKTVKDYGITREEQDAYAIESYKKASNAWSSEK 194

  Fly   194 FDKEIVPVEIKDRKGTTTFSKDEYIKAGSTVEG-IQKLRAAF-KEG-GSITAGNASGVNDSAAAV 255
            |.:|:|||.:|..:.....::||..|  ..:|. :..|:..| ::| |:||..|||.:||.|.|.
 Worm   195 FSEEVVPVSVKTSRSEVVITEDEEYK--KLIESKVSSLKPVFVRDGTGTITPANASSLNDGAVAT 257

  Fly   256 LLMSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAA 320
            ::: ||....:|..|||.:|.:.::|..|....:.||.||..||:|...:..::.|:|||||||.
 Worm   258 VVV-GENALPQGAHPLAELVAFAEAGRAPIDFTVAPVDAVRLLLKKSGLQVSDIALWELNEAFAV 321

  Fly   321 QSLAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIA 385
            ..||.:::|.::...|||.|||:|:|||:|.||.|::.:|.|:|  ..|:.|:|::|.|||...|
 Worm   322 TVLAFIKELNIEPSVVNVKGGAVAIGHPLGMSGLRIVNSLAYSL--APGQLGVAAICNGGGEATA 384

  Fly   386 LAVERL 391
            :.:::|
 Worm   385 VLIKKL 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 150/395 (38%)
thiolase 5..390 CDD:238383 146/388 (38%)
T02G5.7NP_495456.1 thiolase 7..389 CDD:238383 146/388 (38%)
AcCoA-C-Actrans 8..388 CDD:273881 145/386 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D321628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.