DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and CG10932

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001284987.1 Gene:CG10932 FlyBaseID:FBgn0029969 Length:410 Species:Drosophila melanogaster

Alignment Length:394 Identity:167/395 (42%)
Similarity:245/395 (62%) Gaps:8/395 (2%)


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            :::|.:|||||||||||...|:.|.|:.||:..|:..:.:|.:...:|.|||:|..:|||.||.|
  Fly    22 IAEVVVVSAARTPIGSFQSQLAPLTATQLGARAIEAAIEKAGIAKTDVQEVIMGNVVSAGLGQAP 86

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            ||||::.||||..|....:|.:|.||:|.|.||.|::..|.|.:|||||.||||..|:  :|::|
  Fly    87 ARQAAIFAGLPTNVCCTTVNKVCSSGMKAVMLGAQSLMLGYADVVVAGGMESMSNVPY--YLKRG 149

  Fly   131 -VKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYF 194
             ...|...:.|.::.|||.|.....|||..|||.|.|..|:|:.||.:|:.|..|:..|.....|
  Fly   150 ATPYGGVNLTDGIVFDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVF 214

  Fly   195 DKEIVPVEIKD-RKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVLL 257
            ..||.||:|:. ||.....|:||..|. ...:...:|...| :|.|::||||||.:||..|||:|
  Fly   215 QDEIAPVKIQQKRKPEIVISEDEEYKR-VNFDKFGQLATVFQRENGTVTAGNASTLNDGGAAVVL 278

  Fly   258 MSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQS 322
            ||.|...:.|:|||||||.:..:..:|....:.|..|:..||::...::|:|.::|:||||:...
  Fly   279 MSAEAAQKAGIKPLARIVAFQDAETDPIDFPIAPALAIPKLLKRAGVRKEDVAMWEVNEAFSLVV 343

  Fly   323 LAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALA 387
            ||.::.|.:|..||||:|||:::|||||.||||::..|.::|::  |..|.||:|.|||...::.
  Fly   344 LANIKKLDVDPAKVNVHGGAVSIGHPIGMSGARLVAHLSHSLKK--GELGCASICNGGGGASSIL 406

  Fly   388 VERL 391
            :|:|
  Fly   407 IEKL 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 166/393 (42%)
thiolase 5..390 CDD:238383 165/388 (43%)
CG10932NP_001284987.1 PLN02644 24..410 CDD:215347 166/391 (42%)
thiolase 26..409 CDD:238383 165/388 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56925240
eggNOG 1 0.900 E1_COG0183
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D321628at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 1 1.100 P PTHR18919
RoundUp 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.