DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and Acat1

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_058771.2 Gene:Acat1 RGDID:2016 Length:424 Species:Rattus norvegicus

Alignment Length:394 Identity:172/395 (44%)
Similarity:247/395 (63%) Gaps:8/395 (2%)


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            ::||.||||.|||||||.|:|:...|:.||::.||..:.:|.:..:||.||.:|..:..|:||.|
  Rat    36 LNDVVIVSATRTPIGSFLGSLASQPATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAP 100

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            .|||:|.|||||..|...:|.:|.||:|.:.:..|::..|...::||||.||||..|:||. |..
  Rat   101 TRQATLGAGLPIATPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMS-RGA 164

  Fly   131 VKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFD 195
            ...|...:.|.::.|||||....||||..|||.|.|.:||||.||.||:.|..|::||...|.|.
  Rat   165 TPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKLSISREEQDKYAIGSYTRSKEAWDAGKFA 229

  Fly   196 KEIVP--VEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVLL 257
            .||.|  :.:|.:........:||.:.  ....:.||:..| ||.|::||.|||.:||.||||:|
  Rat   230 NEITPITISVKGKPDVVVKEDEEYKRV--DFSKVPKLKTVFQKENGTVTAANASTLNDGAAAVVL 292

  Fly   258 MSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQS 322
            |:.|...|..:||||||..:..:.::|....|.|..||..:|:....|:|::.::|:||||:...
  Rat   293 MTAEAAQRLKVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVV 357

  Fly   323 LAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALA 387
            ||.::.|::|.|||||:|||::||||||.||||::|.|.:||::  |..|:||:|.|||...|:.
  Rat   358 LANIKMLEIDPQKVNVHGGAVSLGHPIGMSGARIVVHLAHALKQ--GEFGLASICNGGGGASAVL 420

  Fly   388 VERL 391
            :|:|
  Rat   421 IEKL 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 171/393 (44%)
thiolase 5..390 CDD:238383 169/388 (44%)
Acat1NP_058771.2 PLN02644 38..424 CDD:215347 171/391 (44%)
thiolase 40..423 CDD:238383 169/388 (44%)
Coenzyme A binding. {ECO:0000250} 255..257 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D321628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.