DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and kat-1

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_495455.2 Gene:kat-1 WormBaseID:WBGene00002183 Length:407 Species:Caenorhabditis elegans

Alignment Length:389 Identity:155/390 (40%)
Similarity:234/390 (60%) Gaps:8/390 (2%)


  Fly     5 FIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPARQA 69
            |||.|||||||||..:||.:.|.:|.||.|:..|.|..|:...:.||.|||...|..||.|||||
 Worm    25 FIVGAARTPIGSFRSSLSSVTAPELASVAIKAALERGAVKPSSIQEVFLGQVCQANAGQAPARQA 89

  Fly    70 SLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG-VKM 133
            :|.|||.:.|....:|.:|.||||.:.|..|.|::|.....:.||.||||..|  .::::| :..
 Worm    90 ALGAGLDLSVAVTTVNKVCSSGLKAIILAAQQIQTGHQDFAIGGGMESMSQVP--FYVQRGEIPY 152

  Fly   134 GPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKEI 198
            |...::|.::.||||||.:.:|||...|..:.:..|:|:.||.||:.|..::.:|.:.|....|:
 Worm   153 GGFQVIDGIVKDGLTDAYDKVHMGNCGEKTSKEMGITRKDQDEYAINSYKKSAKAWENGNIGPEV 217

  Fly   199 VPVEIKDRKGTTTFSKD-EYIKAGSTVEGIQKLRAAFKEGGSITAGNASGVNDSAAAVLLMSGEE 262
            |||.:|.:||.|...|| |:.|.  ..:....||..|::.|:|||.|||.:||.||||::.|.|.
 Worm   218 VPVNVKSKKGVTIVDKDEEFTKV--NFDKFTSLRTVFQKDGTITAANASTLNDGAAAVIVASQEA 280

  Fly   263 VARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVLQ 327
            |:.:.|||||||:.:..:...|....:.|......:|::...|:.:|..:|:||||:...||.::
 Worm   281 VSEQSLKPLARILAYGDAATHPLDFAVAPTLMFPKILERAGVKQSDVAQWEVNEAFSCVPLAFIK 345

  Fly   328 DLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVERL 391
            .|.:|...||.:|||:::|||||.||||::..|::.|:  .|:.|:|::|.|||....:.:::|
 Worm   346 KLGVDPSLVNPHGGAVSIGHPIGMSGARLITHLVHTLK--SGQIGVAAICNGGGGSSGMVIQKL 407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 154/388 (40%)
thiolase 5..390 CDD:238383 154/387 (40%)
kat-1NP_495455.2 thiolase 25..406 CDD:238383 154/387 (40%)
PLN02644 26..407 CDD:215347 153/387 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D321628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.