DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and Acat2

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_033364.2 Gene:Acat2 MGIID:87871 Length:397 Species:Mus musculus

Alignment Length:389 Identity:231/390 (59%)
Similarity:295/390 (76%) Gaps:2/390 (1%)


  Fly     4 VFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNPARQ 68
            |.|||||||.||||||.||.:...::|:.||:|||:||.|..:||:|||.|..|:||.||||.||
Mouse     8 VVIVSAARTAIGSFNGALSTVPVHEMGTTVIKEVLQRAKVAPEEVSEVIFGHVLTAGCGQNPTRQ 72

  Fly    69 ASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQGVKM 133
            ||:.||:|..|||:...|:||||||.|.|..|:|..||:.||||||.|:||.|||:.|||.||:|
Mouse    73 ASVGAGIPYSVPAWSCQMICGSGLKAVCLAAQSIAMGDSTIVVAGGMENMSKAPHLTHLRTGVRM 137

  Fly   134 GPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFDKEI 198
            |...:.||::.||||||..|.||||||||:|.|:.:||||||..|||||||||.|||.|:|||||
Mouse   138 GEVPLADSILCDGLTDAFHNYHMGITAENVAKKWQVSREAQDKVAVLSQNRAEHAQKAGHFDKEI 202

  Fly   199 VPVEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEG-GSITAGNASGVNDSAAAVLLMSGE 261
            |||.:..|||.|....||:.:.||.:|.:.||:..| .:| |::|..||||:||.||||:||...
Mouse   203 VPVLVSSRKGLTEVKIDEFPRHGSNLEAMGKLKPYFLTDGTGTVTPANASGMNDGAAAVVLMKKT 267

  Fly   262 EVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQSLAVL 326
            |..|:.||||||||.|:|:|:||.|||:||:.|::..:.|..|..|:|||:|:||||||.|.|:.
Mouse   268 EAERRMLKPLARIVSWSQAGVEPSVMGVGPIPAIKQAVAKAGWSLEDVDLFEINEAFAAVSAAIA 332

  Fly   327 QDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALAVER 390
            ::|.|:.:|||::|||||||||:||||.|:|||||:.|||.||.:|:|:||||||||:|:.|:|
Mouse   333 KELGLNPEKVNIDGGAIALGHPLGASGCRILVTLLHTLERVGGTRGVAALCIGGGMGVAMCVQR 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 231/390 (59%)
thiolase 5..390 CDD:238383 229/387 (59%)
Acat2NP_033364.2 PRK05790 8..396 CDD:180261 230/388 (59%)
thiolase 9..396 CDD:238383 229/387 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C56879658
eggNOG 1 0.900 E1_COG0183
Hieranoid 1 1.000
Homologene 1 1.000 H55855
Inparanoid 1 1.050 458 1.000 Inparanoid score I1557
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1129049at2759
OrthoFinder 1 1.000 FOG0005252
OrthoInspector 1 1.000 T617067
orthoMCL 1 0.900 OOG5_126757
Panther 1 1.100 LDO PTHR18919
Phylome 1 0.910 0.672 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R12059
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.