DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9149 and Acat1

DIOPT Version :9

Sequence 1:NP_612094.2 Gene:CG9149 / 38147 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_659033.1 Gene:Acat1 / 110446 MGIID:87870 Length:424 Species:Mus musculus


Alignment Length:394 Identity:170/394 - (43%)
Similarity:245/394 - (62%) Gaps:8/394 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            :::|.||||.|||||||.|:|:...|:.||:..||..:.:|.:..:||.||.:|..:..|:||.|
Mouse    36 LNEVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAP 100

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            .|||:|.|||||..|...:|.:|.||:|.:.:..|::..|...::||||.||||..|:||. |..
Mouse   101 TRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMS-RGA 164

  Fly   131 VKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFD 195
            ...|...:.|.::.|||||....||||..|||.|.|.||||:.||.||:.|..|::||...|.|.
Mouse   165 TPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFA 229

  Fly   196 KEIVP--VEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVLL 257
            .||.|  :.:|.:........:||.:.  ....:.||:..| ||.|:|||.|||.:||.|||::|
Mouse   230 SEITPITISVKGKPDVVVKEDEEYKRV--DFSKVPKLKTVFQKENGTITAANASTLNDGAAALVL 292

  Fly   258 MSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQS 322
            |:.|...|..:||||||..:..:.::|....|.|..||..:|:....|:|::.::|:||||:...
Mouse   293 MTAEAAQRLNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVV 357

  Fly   323 LAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALA 387
            ||.::.|::|.||||::|||::||||||.||||::|.:.:||:  .|..|:||:|.|||...||.
Mouse   358 LANIKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALK--PGEFGLASICNGGGGASALL 420

  Fly   388 VERL 391
            :|:|
Mouse   421 IEKL 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 169/392 (43%)
thiolase 5..390 CDD:238383 167/387 (43%)
Acat1NP_659033.1 PLN02644 38..424 CDD:215347 169/390 (43%)
thiolase 40..423 CDD:238383 167/387 (43%)
Coenzyme A binding. /evidence=ECO:0000250|UniProtKB:P24752 255..257 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60894
OrthoDB 1 1.010 - - D321628at33208
OrthoFinder 1 1.000 - - FOG0000432
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100472
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.