DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9149 and Acat1

Sequence 1:NP_612094.2 Gene:CG9149 FlyBaseID:FBgn0035203 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_659033.1 Gene:Acat1 MGIID:87870 Length:424 Species:Mus musculus

Alignment Length:394 Identity:170/395 (43%)
Similarity:245/395 (62%) Gaps:8/395 (2%)


  Fly     1 MSDVFIVSAARTPIGSFNGTLSKLKASDLGSVVIQEVLRRANVEGQEVNEVILGQALSAGQGQNP 65
            :::|.||||.|||||||.|:|:...|:.||:..||..:.:|.:..:||.||.:|..:..|:||.|
Mouse    36 LNEVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAP 100

  Fly    66 ARQASLKAGLPIQVPAYGINMLCGSGLKTVALGYQAIRSGDAQIVVAGGQESMSLAPHVMHLRQG 130
            .|||:|.|||||..|...:|.:|.||:|.:.:..|::..|...::||||.||||..|:||. |..
Mouse   101 TRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMS-RGA 164

  Fly   131 VKMGPGTMVDSMIHDGLTDAMENIHMGITAENLADKYNISREAQDAYAVLSQNRAEEAQKKGYFD 195
            ...|...:.|.::.|||||....||||..|||.|.|.||||:.||.||:.|..|::||...|.|.
Mouse   165 TPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKKMNISRQEQDTYALSSYTRSKEAWDAGKFA 229

  Fly   196 KEIVP--VEIKDRKGTTTFSKDEYIKAGSTVEGIQKLRAAF-KEGGSITAGNASGVNDSAAAVLL 257
            .||.|  :.:|.:........:||.:.  ....:.||:..| ||.|:|||.|||.:||.|||::|
Mouse   230 SEITPITISVKGKPDVVVKEDEEYKRV--DFSKVPKLKTVFQKENGTITAANASTLNDGAAALVL 292

  Fly   258 MSGEEVARKGLKPLARIVGWTQSGIEPKVMGLGPVTAVEALLQKINWKREEVDLYELNEAFAAQS 322
            |:.|...|..:||||||..:..:.::|....|.|..||..:|:....|:|::.::|:||||:...
Mouse   293 MTAEAAQRLNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVV 357

  Fly   323 LAVLQDLQLDAQKVNVNGGAIALGHPIGASGARVLVTLLYALERTGGRKGIASLCIGGGMGIALA 387
            ||.::.|::|.||||::|||::||||||.||||::|.:.:||:  .|..|:||:|.|||...||.
Mouse   358 LANIKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALK--PGEFGLASICNGGGGASALL 420

  Fly   388 VERL 391
            :|:|
Mouse   421 IEKL 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9149NP_612094.2 PRK05790 1..391 CDD:180261 169/393 (43%)
thiolase 5..390 CDD:238383 168/388 (43%)
Acat1NP_659033.1 PLN02644 38..424 CDD:215347 169/391 (43%)
thiolase 40..423 CDD:238383 168/388 (43%)
Coenzyme A binding. {ECO:0000250} 255..257 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D321628at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126757
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.