DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32333 and ROG1

Sequence 1:NP_001261246.1 Gene:CG32333 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:NP_011371.1 Gene:ROG1 SGDID:S000003112 Length:685 Species:Saccharomyces cerevisiae

Alignment Length:448 Identity:83/449 (18%)
Similarity:153/449 (34%) Gaps:138/449 (31%)


  Fly  1042 ALPPTGKTKIVACHLPPPLKERQPIGAIDNPV--YHIYE------------------SLRPISTP 1086
            :|.||.:   :..|....:|    :|.::..|  ||:|:                  ::.|:|..
Yeast     2 SLTPTNE---ILFHYKSSVK----VGELERYVITYHLYDGEEIPPDLNLNSLWLKVRNMNPLSYR 59

  Fly  1087 AIFSNKPVLKSHSLAELKRPQNLPNHSINHHCKTHAINANGNVLENGLDHEQDEIKENSNGQVR- 1150
            |.:...|.:   ...::|..|       .||.:....:.:....|..:..:||.:.|.|...:| 
Yeast    60 AAYLMGPFM---LYCDVKTAQ-------YHHSQKIVASVDYPKFEPNVQTQQDFVAELSVHNIRQ 114

  Fly  1151 --------TNKQGHGSNTNSKHKRKGQLASAVQEAPPSISLLEFEKYREEFRKQIKYQGSI--YS 1205
                    .::....:|||                                   :.|:.:|  ..
Yeast   115 KYVWIADVMSQILFTTNTN-----------------------------------VTYEVTIGTSK 144

  Fly  1206 DYVQLASELPYFYISDEYRAFSP-----------------------NGMHLVICVHGLDGN-SAD 1246
            :.|:...:||     ....::||                       ...|||:..|||..| |.|
Yeast   145 ESVENPHDLP-----SHLGSYSPKLTVNRLTTLDLWNLPVQITTPQKKKHLVVLTHGLHSNVSTD 204

  Fly  1247 LRLVRTYLELGLPGVNLEFLMSERNQGD---TFSDFDTMTDRLVTEILYHIDSCALNPARISFVA 1308
            |..:...:.........|.::.:..:|:   |......:..||...|:..:...::.  :||||.
Yeast   205 LVYIMEQIYKAQKNYPHEQIVVKGYRGNVCQTEKGVKYLGTRLAEYIIQDLYDESIR--KISFVG 267

  Fly  1309 HSLGTIIVRSALAR---------PQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWK 1364
            ||||.:|...|:|.         .::.|:     .|::|:.|.||.:.:....:.:.:.| ....
Yeast   268 HSLGGLIQAFAIAYIYEVYPWFFKKVNPI-----NFITLASPLLGIVTDNPAYIKVLLSF-GVIG 326

  Fly  1365 KSGSLLQLCMRDTTDMRNSFLYRLSQR---STLHHFK-NILLCGSSQDRYVPAHSARL 1418
            |:|.  .|.:.:..::....||.||..   ..|..|| ..:...:..|..||.::|.|
Yeast   327 KTGQ--DLGLENDVEVGKPLLYLLSGLPLIEILRRFKRRTVYANAINDGIVPLYTASL 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180
MhpC 1223..>1447 CDD:223669 51/237 (22%)
DUF676 1227..1422 CDD:282860 51/233 (22%)
ROG1NP_011371.1 DUF676 184..382 CDD:282860 48/208 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113114089
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.