| Sequence 1: | NP_001261246.1 | Gene: | CG32333 / 38142 | FlyBaseID: | FBgn0052333 | Length: | 1499 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_011371.1 | Gene: | ROG1 / 852733 | SGDID: | S000003112 | Length: | 685 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 448 | Identity: | 83/448 - (18%) |
|---|---|---|---|
| Similarity: | 153/448 - (34%) | Gaps: | 138/448 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1042 ALPPTGKTKIVACHLPPPLKERQPIGAIDNPV--YHIYE------------------SLRPISTP 1086
Fly 1087 AIFSNKPVLKSHSLAELKRPQNLPNHSINHHCKTHAINANGNVLENGLDHEQDEIKENSNGQVR- 1150
Fly 1151 --------TNKQGHGSNTNSKHKRKGQLASAVQEAPPSISLLEFEKYREEFRKQIKYQGSI--YS 1205
Fly 1206 DYVQLASELPYFYISDEYRAFSP-----------------------NGMHLVICVHGLDGN-SAD 1246
Fly 1247 LRLVRTYLELGLPGVNLEFLMSERNQGD---TFSDFDTMTDRLVTEILYHIDSCALNPARISFVA 1308
Fly 1309 HSLGTIIVRSALAR---------PQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWK 1364
Fly 1365 KSGSLLQLCMRDTTDMRNSFLYRLSQR---STLHHFK-NILLCGSSQDRYVPAHSARL 1418 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32333 | NP_001261246.1 | DUF3657 | 150..226 | CDD:289180 | |
| MhpC | 1223..>1447 | CDD:223669 | 51/236 (22%) | ||
| DUF676 | 1227..1422 | CDD:282860 | 51/232 (22%) | ||
| ROG1 | NP_011371.1 | DUF676 | 184..382 | CDD:309968 | 48/207 (23%) |
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C157341326 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||