DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32333 and AT1G09980

Sequence 1:NP_001261246.1 Gene:CG32333 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:NP_001320302.1 Gene:AT1G09980 AraportID:AT1G09980 Length:802 Species:Arabidopsis thaliana

Alignment Length:454 Identity:139/455 (31%)
Similarity:215/455 (47%) Gaps:70/455 (15%)


  Fly  1076 IYESLRPISTP---------AIFSNKPVLKSHSLAELKRPQNLPNHSINHHCKTH-AINANGNVL 1130
            |.|.||.|.|.         .::| |..:..|.::.:   :::.|||.:....|. .:|....|.
plant   372 ILEYLRDIWTKDRRAEWSIWMVYS-KVEMPHHFISGM---EDISNHSSHKRVSTGLKLNDPAQVA 432

  Fly  1131 ENGLDHEQDEIKENSNGQVRTNKQGHGSNTNSKHKRKGQLASAVQEA-----PPSISLLEFEKYR 1190
            ..     :.|:...|..|:|.|.:                  |:|:.     |..:.::..|:..
plant   433 ST-----RAELHRRSIAQMRINNR------------------AIQDMHIFGDPMRVPIVIIERVW 474

  Fly  1191 EEFRKQIKYQGSIYSDYV-QLASELPYFYISDEYRAFSPNGMH------LVICVHGLDGNSADLR 1248
            ...|:  .:..:.|..:| ::.|.|...:..:.......|..|      :|:.|||..|:..|||
plant   475 NAPRR--TFSDNSYMRHVDRIDSSLLNGHDDESGTKKHINPQHTGRELKIVVFVHGFQGHHLDLR 537

  Fly  1249 LVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEIL--------YHIDSCALNPARIS 1305
            |:|....|..|  .:||||||.|:..|..||..|..||..|::        .|.....|...::|
plant   538 LIRNQWLLIDP--KIEFLMSEANEERTHGDFREMGQRLAQEVVSFFKRKKDKHARYGRLKNIKLS 600

  Fly  1306 FVAHSLGTIIVRSALARPQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLL 1370
            ||.||:|.:|:|:|:|...|.|.....||::||||||||.||:::.|.|.|:|.::|.|.:..:.
plant   601 FVGHSIGNVIIRAAIADSLMDPYRKYFHTYISLSGPHLGYLYSSNSLFNSGLWLLKKLKSTQVIH 665

  Fly  1371 QLCMRDTTDMRNSFLYRLSQRSTLHHFKNILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIY 1435
            ||.:.|..|::|:|.|:|.::.||..||||:|..|.||.|||.||||:|.|:.|..|:|..|..:
plant   666 QLTLTDDPDLQNTFFYKLCKQKTLCSFKNIILLSSPQDGYVPYHSARIESCQPASFDNSKRGVAF 730

  Fly  1436 REMVHNII------APILARPELTLARFDVHH---ALPHTANTLIGRAAHIAVLDSELFIEKFM 1490
            .||::|.:      :|.....:....|.||:.   ......|:.|||||||..|:|::|....|
plant   731 LEMLNNCMDQIRGPSPETPHHQRVFMRCDVNFDTTLYGRNLNSFIGRAAHIEFLESDVFARFIM 794

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180
MhpC 1223..>1447 CDD:223669 95/244 (39%)
DUF676 1227..1422 CDD:282860 87/209 (42%)
AT1G09980NP_001320302.1 DUF3657 147..208 CDD:289180
DUF676 519..718 CDD:282860 85/201 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I1092
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124845
orthoMCL 1 0.900 OOG5_129686
Panther 1 1.100 O PTHR12482
Phylome 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.