DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32333 and fam135a

Sequence 1:NP_001261246.1 Gene:CG32333 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:XP_004914560.1 Gene:fam135a XenbaseID:XB-GENE-993079 Length:1503 Species:Xenopus tropicalis

Alignment Length:1721 Identity:521/1722 (30%)
Similarity:771/1722 (45%) Gaps:442/1722 (26%)


  Fly     1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGAN 65
            |.::|||:||.|||.||:||||||||.||:|..:::.||:..::|.|:...:             
 Frog     1 MSEVQATVEFSVELQKFYNVDLFQRGFYQIRTSMKIPPRIPHKIEASLLRIT------------- 52

  Fly    66 ATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRS 130
                       |:|:                ..|||.:....|:||||||:|||:.:.|::.|:.
 Frog    53 -----------GDLA----------------FPASVQDTVVFSKIFQILYKNEEITVNDVMIFKI 90

  Fly   131 HLLVDSRHLKESIERAEFSLQLELWFGEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNLQL 195
            .:|:|.|.::|::....|.:.::|:|.:.:                :|....:||.|.|:|:|:|
 Frog    91 KMLLDERKIEETLNELNFQMFIDLYFTDTD----------------YSPNDPNALQLISSRSLKL 139

  Fly   196 NFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYIK-----KSVFSYMKFCAPRSSKPWS 255
            :|:..||||.|:.|:||||||:.|||.||.||||||||.|.     |:  :::...||..||   
 Frog   140 HFNLHRGLHDHINVMFDYFHLSVISVVIHGSLVALHQPLISFHRVIKN--TWLNRNAPAQSK--- 199

  Fly   256 AGKLSCRGNTSPGPLEAVFFGPQIGGTTKCSGGPAGRLLQ------SRAIHREICSLLLGAIEQL 314
                    .:|...||:|.||...  |.:.|......::|      :.:.|..:|:.||.|.:.|
 Frog   200 --------ESSIPTLESVVFGSSY--TKQLSADGNSFVVQDCFLQHAYSFHSTLCACLLFAFKGL 254

  Fly   315 KATLNEFSTVLPPSINSQIGSPPLRENDTGERLQLLLDQAKQLEAEEDFAIRANSDIAQLCAESI 379
            .:.....|..||||:..:     |.:.|...||..|.::.|::|..::.|...|.::||||:..:
 Frog   255 DSYFITVSKELPPSLKLE-----LEKIDVDARLTELCEEVKKIENPDELAELINMNLAQLCSLLM 314

  Fly   380 FWWRRVLLASRSSTAVHTLLARKHHILRVRRFAEGFFVLEQPRHAAAAGCPDQTNGSPSPGHCQG 444
            ..|.:.|........:.|.:|::|||||||||||.||.||.||.||.|         ....|.|.
 Frog   315 ALWGQFLEVVVLQDEITTFIAQQHHILRVRRFAEAFFCLEHPRQAALA---------YQELHAQS 370

  Fly   445 YVAIAELARRSRYLQSLPPLPVHCTPIDGDASSLPLIFEDRYV------------------TTNS 491
            ::.::...:.|.|..||||||:.|:.:|||.:|||:||||||:                  ..:|
 Frog   371 HLQMSTAIKNSSYFSSLPPLPIECSELDGDFTSLPIIFEDRYLDYIMEDLDGPWLGAQNLQRLDS 435

  Fly   492 TYARRRSGSDPQLEDAVSVV-----------------------GVQKKKVDKTHSSSSLNGIKDC 533
            :...:....:..:...||.|                       ..:.|..|:|.|.:.:|.:...
 Frog   436 SKQEKHDNDEESVRGPVSPVLKVRTEGASTPAWCTEGDKQLAKSQKGKNEDETKSKTKVNKLMKS 500

  Fly   534 LACHFDYDYP-----QTNGSGPAHPHAKCVITPRFALGGEVLQASLTIAPSKEAAPEAVAP---- 589
            :    .::.|     |.:.........||:                     |.|..|:::.    
 Frog   501 M----KHENPKKIVKQNSKESVVLVSYKCL---------------------KAATAESMSKPFEG 540

  Fly   590 -PTLRHNLSRHSVTGLLEDLDLDSS----LPARHSKSLDQLDGCEG--LAT------NPVSTTNN 641
             |:..|...|:.:.|.|.. |..||    |...|: ||....|...  |||      |..||.|.
 Frog   541 RPSHCHKDGRNHMQGFLPS-DTKSSGLQTLQKGHT-SLSSNAGTNKPLLATFDSTQRNQSSTWNT 603

  Fly   642 HTLPRLQADDLMRNICEFRQRYGKFDYLHEIKLLNPPKQQQQAVPQQ-----QQQCNNGYNSLPK 701
            ..|....|..::..:...:...|         |:......|..||::     |....:|..|:  
 Frog   604 GNLTPFSASAILGTLSMQQAGTG---------LMPLDSALQTVVPEESFHGNQTMIPSGVRSI-- 657

  Fly   702 SMVPPRNSYPPPPPSQHTTMPRSSSSQIPRAVEIARVRVSDIKEMLRQGQLRKESSSSESDMMQK 766
             :|.|.|.  .|...:..|:...|..      |:...|::      :.|...:.::.....|...
 Frog   658 -VVKPCNK--NPFEGEKVTVLLGSKP------EMCNDRIT------KDGLQEQGNAPLHGGMASS 707

  Fly   767 LQM---------------LSSNSVPFRLEGTSNNNTT---------SSD----PN------TSGF 797
            |.|               |:.|...| |:..||..||         |||    |:      :|.|
 Frog   708 LNMDTTFNKNVALDTNFTLTGNPESF-LKVKSNLQTTMSKEVHIVVSSDTIKLPDINLTCASSRF 771

  Fly   798 SES---------------------------------LPNLAPPPEFDSDSQLRRQRSNSTSSLSE 829
            |:|                                 ||:|...||.:..:.:....:.|||:|||
 Frog   772 SDSGVESEPSSFSTHPNPEPNVEDQMAPGAVVTDKVLPHLLLKPESNCKTAVETHCTESTSALSE 836

  Fly   830 ESGWVSSRRSSLAIS---SPDTITSTGMTN---RQRHTQLNLGMGMAMETRLNGEQLRLRLQKV- 887
            ....::|..|..:..   |||..:...:|.   :...|.|:||.....:|......:.|:.|.| 
 Frog   837 IQSSLTSINSLPSDDDELSPDEASKISVTESKLKDSKTVLDLGTVDLPKTDSKKSSILLQPQCVV 901

  Fly   888 ------------------LEQQQLQQQHPHKNRKRQAGTSSQSRTPARQ-QT-EVHKKISSVTVN 932
                              |.|..:..:......|......|.|.|..|: || :.|...:..|:|
 Frog   902 FSDNETVSVHSSLSSIRDLFQFAISDEETPNEVKSIPVPMSNSITTLRELQTHDKHLGATQGTMN 966

  Fly   933 ----IKRERS-----------------RYQLDRLRHLPNGESTEVEEMEPPPRRNRHKTACEKSK 976
                :..|||                 .|....|.....|.|....|       |:..||...|.
 Frog   967 TEVIVFGERSIISGSVACDNRPQQGILEYGETGLNQTSKGSSAVTGE-------NQTGTANLSSN 1024

  Fly   977 SDFDI---------------TSLKDMQPLDAVCLPPPQQFQDQEQELALVLAPPPPDEFRDPPPE 1026
            |..|:               |.:.|:.|.|.|     :.....::.:..:|..||..|..|    
 Frog  1025 SSSDMVKQGLVENYFGSQSSTDISDISPADDV-----KYAASAKENVKHLLEGPPVSEEID---- 1080

  Fly  1027 PAPAAPIAPVPPPAAALPPTGKTKIVACHLPPPLKERQPIGAIDN--------PVYHIYESLRPI 1083
                                              :|.|....|:|        |:|...:::..:
 Frog  1081 ----------------------------------EEEQDEDMIENGYYEETDGPLYRSDDTVCEV 1111

  Fly  1084 STPAIFSNKPVLKSHSLAE--LKRPQNLPNHSINHHCKTHAI--NANGNVLENGLDHEQDEIKEN 1144
            ...:  :|:..|:|..::.  |:...|:|. .....|..:.:  :.:|....             
 Frog  1112 EFES--ANEKCLRSEQISSEYLRDSMNMPG-VCTPSCFPYTLRESPSGTAFP------------- 1160

  Fly  1145 SNGQVRT-NKQGHGSNTNSKHKRKGQLASAVQEAPPSISLLEFEKYREEFRKQIKYQGSIYSDYV 1208
            |...:.| .||..|:.::|         .:..|:.|...:|.|.:.:||. ||::..|.:|||..
 Frog  1161 SRNMIDTITKQPGGATSSS---------LSWYESSPKPLMLAFLQAKEEL-KQLRLPGFLYSDVP 1215

  Fly  1209 QLASELPYFYISDEYRAFSPN-GMHLVICVHGLDGNSADLRLVRTYLELGLPGVNLEFLMSERNQ 1272
            ||||.:|||.:.::   ..|: |:||::||||||||||||||||||:||||||...|||||||||
 Frog  1216 QLASSVPYFSMEED---DDPDEGIHLIVCVHGLDGNSADLRLVRTYIELGLPGGRKEFLMSERNQ 1277

  Fly  1273 GDTFSDFDTMTDRLVTEILYHIDSCALNPARISFVAHSLGTIIVRSALARPQMRPLLPRLHTFLS 1337
            .|||:|||:|||||:.||:.:|...:|:.:||||:.||||.:|:||.|:||:.:..|.:||||||
 Frog  1278 NDTFADFDSMTDRLLDEIVQYIQIYSLSVSRISFIGHSLGNLIIRSVLSRPRFKCYLSKLHTFLS 1342

  Fly  1338 LSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLLQLCMRDTTDMRNSFLYRLSQRSTLHHFKNILL 1402
            |||||||||||:|.|||.|:|||||||||||||||..||.:|.|.:|||:||::..|.:|:|::|
 Frog  1343 LSGPHLGTLYNSSALVNTGLWFMQKWKKSGSLLQLTCRDNSDPRQTFLYKLSKKPGLEYFRNVVL 1407

  Fly  1403 CGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNIIAPILARPELTLARFDVHHALPHTA 1467
            ..|.||||||.||||:|:||.|::|..| |.:|.||:.||::|:|...:..|.|:||.||||:||
 Frog  1408 VSSLQDRYVPYHSARIEMCKTALKDKQS-GPVYAEMIQNILSPVLQNKDCNLVRYDVIHALPNTA 1471

  Fly  1468 NTLIGRAAHIAVLDSELFIEKFMLIAGLKYF 1498
            |:||||||||||||||:|:|||.|:|||:||
 Frog  1472 NSLIGRAAHIAVLDSEVFLEKFFLVAGLRYF 1502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180 28/76 (37%)
MhpC 1223..>1447 CDD:223669 141/225 (63%)
DUF676 1227..1422 CDD:282860 130/196 (66%)
fam135aXP_004914560.1 DUF3657 110..170 CDD:289180 28/76 (37%)
DUF676 1232..1427 CDD:282860 130/195 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113111115
eggNOG 1 0.900 E1_KOG2205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1132320at2759
OrthoFinder 1 1.000 FOG0001201
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.