DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32333 and FAM135B

Sequence 1:NP_001261246.1 Gene:CG32333 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:XP_011515358.1 Gene:FAM135B HGNCID:28029 Length:1410 Species:Homo sapiens

Alignment Length:1703 Identity:514/1704 (30%)
Similarity:707/1704 (41%) Gaps:499/1704 (29%)


  Fly     1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGAN 65
            |.::|.|:||.||||||:||||||||.||:|..|:||.|:..::..||               |.
Human     1 MSEIQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASI---------------AG 50

  Fly    66 ATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRS 130
            .|:..|               ||         ||.|.:.:..||:|||||||||||:.|.:.||.
Human    51 QTESSS---------------LH---------SACVHDSTVHSRVFQILYRNEEVPINDAVVFRV 91

  Fly   131 HLLVDSRHLKESIERAEFSLQLELWFGEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNLQL 195
            |||:....:::::...:|.|:::|.|  .:....|....|.              .:.|:|.|.|
Human    92 HLLLGGERMEDALSEVDFQLKVDLHF--TDSEQQLRDVAGA--------------PMVSSRTLGL 140

  Fly   196 NFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYIKKSVFSYMKFCAPRSSKPWSAGKLS 260
            :|||..|||:.:||:||||||:.|||.:||:||||.||.|        .|..|        |:.|
Human   141 HFHPRNGLHHQVPVMFDYFHLSVISVTVHAALVALQQPLI--------SFTRP--------GRGS 189

  Fly   261 CRGNTSPG--------PLEAVFFGPQIGGTTKCSGG----PAGRLLQSRAIHREICSLLLGAIEQ 313
            ..|...|.        .||.:.||......|...|.    ....:..:...||::|.|||.|...
Human   190 WLGKGGPDTGQEQSIISLENLVFGAGYCKPTSSEGSFYITSENCMQHAHKWHRDLCLLLLHAYRG 254

  Fly   314 LKATLNEFSTVLPPSINSQIGSPPLRENDTGERLQLLLDQAKQLEAEEDFAIRANSDIAQLCAES 378
            |:.........:|...::::.:..:.|.     |..|..:.:.|...|..|.:.:.|:|.|.:..
Human   255 LRLHFLVIMRDIPELPHTELEALAVEET-----LSQLCSELQMLNNPEKIAEQISKDLAWLTSHM 314

  Fly   379 IFWWRRVLLASRSSTAVHTLLARKHHILRVRRFAEGFFVLEQPRHAAAAGCPDQTNGSPSPGHCQ 443
            :..|.:.|......:.|.|.|.::||.||||||:|.||.:|   |...|....|.|...:  |.|
Human   315 MTLWTQFLDTVTLHSQVTTYLTQEHHTLRVRRFSEAFFYME---HQKLAVLTFQENLIQT--HSQ 374

  Fly   444 GYVAIAELARRSRYLQSLPPLPVHCTPIDGDASSLPLIFEDRYVTTNSTYARRRSGSDPQLEDAV 508
            ..:.|    |.|.||.|:||||..|..||||.::||:|||||||                     
Human   375 LSLDI----RNSEYLTSMPPLPAECLDIDGDWNTLPVIFEDRYV--------------------- 414

  Fly   509 SVVGVQKKKVDKTHSSSSLNGIKDCLACHFDYDYPQTNGSGPAHPHAKCVITPRFALGGEVLQAS 573
                                   ||                ||..| ...:.|.|    :|...|
Human   415 -----------------------DC----------------PATGH-NLSVYPNF----DVPVTS 435

  Fly   574 LTIAPSKEAAPEAVAPPTLRHNLSRHSVTGLLEDLDLDSSLPARHSKSLDQLDGCEGLATNPVS- 637
            .||...|:.....:    :..|||      ..|||.|.:..|:       |:|..|.:...|.. 
Human   436 PTIMNLKDKEDNCM----VNSNLS------FREDLVLSTIKPS-------QMDSDEEVIRCPEPG 483

  Fly   638 ---TTNNHTLPRLQADDLMRNICEFRQRY---GKFDYLHEIKLLNPPKQQQQAVPQQQQQCNNGY 696
               .|.||           .::|...|.|   |:|             |.:..||  :.:|..|.
Human   484 ENVATQNH-----------MDMCSESQVYISIGEF-------------QNKAGVP--EDECWTGQ 522

  Fly   697 NSLPKSMVPPRNSYPPPPPSQHTTMPRSSSSQIPRAVEIARVRVSDIKEMLRQGQLRKESSSSES 761
            .|       ...:||..........|.....|.|....|      |:|                 
Human   523 TS-------DAGTYPVADVDTSRRSPGPEDGQAPVLTYI------DVK----------------- 557

  Fly   762 DMMQKLQMLSSNSVPFRLEGTSNNNTTSSDPNTSGFSESLPNLAPPPEFDSDSQLRRQRSNSTSS 826
                     |||..|.|.|                         |...|::..:.|..|......
Human   558 ---------SSNKNPSRAE-------------------------PLVAFNAQHESRSSRDKYGLD 588

  Fly   827 LSEESGWVSSRRSSLAISSPDTITSTGMTNRQRHTQLNLGMGMAMETRLNGEQLRL--------- 882
            .:..|..|.......||||..|..         |....||.|:..|.::....|:|         
Human   589 RTGLSKVVVGGSHQNAISSDKTTL---------HELSTLGKGIDQEGKMVLLSLKLTPSEPCDPL 644

  Fly   883 --RLQKVLE-QQQLQQQHPHKNR---------KRQAGTSSQSRTPARQQTEVHKKISSVTVNIKR 935
              .|::.|: :..|:..|..:..         ||.:...|.|        .:..:.|||..:..|
Human   645 SSTLREPLDIRSSLKDSHTEEQEELSVLSGVIKRSSSIISDS--------GIESEPSSVAWSEAR 701

  Fly   936 ERSRYQLDRLRHLPNGESTEVEEMEPPPRRNR-HKTACEKSKSDFDITSLKD--MQPLDAVCLPP 997
            .|:       ..||    ::.|.:.|..||:. |:.:.|...::.: |||..  ...|.::...|
Human   702 SRA-------LELP----SDREVLHPFVRRHALHRNSLEGGHTESN-TSLPSGIQASLTSISSLP 754

  Fly   998 PQQFQDQEQELAL------VLAP---PPPDEFRDPPPEPAPAAPIAP---------VPPPAAALP 1044
               |::.|:|:||      |.||   .|.:...|...:........|         .|...:.|.
Human   755 ---FEEDEREVALTKLTKSVSAPHISSPEEAAEDADTKQQDGGFAEPSDMHSKSQGSPGSCSQLC 816

  Fly  1045 PTGKTKIVACHLPPPLKE-------RQPIGAIDNP---------VYHIYESLRPISTPAIFSNKP 1093
            ....|...|.|   ||.|       :|..|.||.|         ..|.....|..:||.:.:...
Human   817 GDSGTDAGADH---PLVEIVLDADNQQGPGYIDIPKGKGKQFDAQGHCLPDGRTENTPGVETKGL 878

  Fly  1094 VLKSHSLAELKRPQNLPNH-SINHHCK--THAINANGNVLEN-------GLDHEQ---------- 1138
            .||...:..|:.|:....| ::....|  ...:|.....|.|       ||...|          
Human   879 NLKIPRVIALENPRTRSLHRALEETPKGMPKDLNVGQQALSNSGISEVEGLSQHQVPELSCTSAA 943

  Fly  1139 DEIKENSNGQVRTN-----------KQGHGSNTNSKHKR----------------KGQ------- 1169
            |.|..||.||...:           .:|..:...:|||.                |.|       
Human   944 DAINRNSTGQQSQSGSPCIMDDTAFNRGVNAFPEAKHKAGTVCPTVTHSVHSQVLKNQELKAGTS 1008

  Fly  1170 -----------------------------------LASAVQEAPP-------------------- 1179
                                               .:|..:|.|.                    
Human  1009 IMGSHLTSAETFTLDSLKAVEVVNLSVSCTATCLPFSSVPKETPARAGFSSKQTLFPITHQPLGS 1073

  Fly  1180 -------SISLLE------------FEKYREEFRKQIKYQGSIYSDYVQLASELPYFYISDEYRA 1225
                   |.:|.|            |.:.:|:|:|::|.:|.:|||...|||::|||...:|...
Human  1074 FGVVSTHSSTLDEEVSERMFSVFSSFYQAKEKFKKELKIEGFLYSDLTVLASDIPYFPPEEEEEN 1138

  Fly  1226 FSPNGMHLVICVHGLDGNSADLRLVRTYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEI 1290
            .. :|:|||:|||||||||||||||:|::||||||..|:|||||:||.|||:|||||||||:.||
Human  1139 LE-DGIHLVVCVHGLDGNSADLRLVKTFIELGLPGGKLDFLMSEKNQMDTFADFDTMTDRLLDEI 1202

  Fly  1291 LYHIDSCALNPARISFVAHSLGTIIVRSALARPQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNM 1355
            :.||....|:.:||||:.||||.||:||.|.||:.|..|.:|||||||||||||||||.|.||:.
Human  1203 IQHIQLYNLSISRISFIGHSLGNIIIRSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTLVST 1267

  Fly  1356 GMWFMQKWKKSGSLLQLCMRDTTDMRNSFLYRLSQRSTLHHFKNILLCGSSQDRYVPAHSARLEL 1420
            |:|.|||.|||||||||..||..|:|..|||:|||::.|.:|||::|..|.||||||.||||:|:
Human  1268 GLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEM 1332

  Fly  1421 CKAAMRDSSSLGTIYREMVHNIIAPILARPELTLARFDVHHALPHTANTLIGRAAHIAVLDSELF 1485
            ||.|::|..: |.:|.||::|::.|::...:.||.|.:|.||||:||||||||||||||||||||
Human  1333 CKTALKDRHT-GPVYAEMINNLLGPLVEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELF 1396

  Fly  1486 IEKFMLIAGLKYF 1498
            :|||.|:|||.||
Human  1397 LEKFFLVAGLNYF 1409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180 28/76 (37%)
MhpC 1223..>1447 CDD:223669 139/224 (62%)
DUF676 1227..1422 CDD:282860 130/195 (67%)
FAM135BXP_011515358.1 DUF3657 111..170 CDD:289180 27/75 (36%)
DUF676 1140..1334 CDD:282860 130/195 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113117600
eggNOG 1 0.900 E1_KOG2205
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 646 1.000 Inparanoid score I788
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1132320at2759
OrthoFinder 1 1.000 FOG0001201
OrthoInspector 1 1.000 T608645
orthoMCL 1 0.900 OOG5_129686
Panther 1 1.100 LDO PTHR12482
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3354
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.