DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG32333 and Fam135b

Sequence 1:NP_001261246.1 Gene:CG32333 FlyBaseID:FBgn0052333 Length:1499 Species:Drosophila melanogaster
Sequence 2:XP_001072719.2 Gene:Fam135b RGDID:1308133 Length:1403 Species:Rattus norvegicus

Alignment Length:1677 Identity:508/1678 (30%)
Similarity:726/1678 (43%) Gaps:454/1678 (27%)


  Fly     1 MGDLQATIEFVVELHKFFNVDLFQRGLYQVRCGLRVSPRLLVQVETSIPEASGPGKQNGHANGAN 65
            |.::|.|:||.||||||:||||||||.||:|..|:||.|:..::..||.                
  Rat     1 MSEVQGTVEFSVELHKFYNVDLFQRGYYQIRVTLKVSSRIPHRLSASIV---------------- 49

  Fly    66 ATDHGSSDSERGELSPGEVPRLHESPPGGSCSSASVINGSGASRIFQILYRNEEVPLRDIIHFRS 130
                |.::|.          .||     .:|...||::    |||||||||||||.:.|.:.||.
  Rat    50 ----GQTESS----------SLH-----SACVHESVVH----SRIFQILYRNEEVSINDAMLFRV 91

  Fly   131 HLLVDSRHLKESIERAEFSLQLELWF--GEQNGSSSLNGNGGGSGMGSFSGPASSALTLASTRNL 193
            |||:|...:::::...||.|:::|.:  .||.             :...:|     ..:.|:|.|
  Rat    92 HLLLDGERVEDALSEVEFQLKVDLHYTDSEQQ-------------LRDVTG-----TPMISSRTL 138

  Fly   194 QLNFHPGRGLHYHLPVLFDYFHLAAISVGIHASLVALHQPYIKKSVFSYMKFCAP-RSSKPWSAG 257
            .|:|||.||||:.:||:||||||:.|||.|||:||||.||.|        .|..| |.|  | .|
  Rat   139 GLHFHPRRGLHHQVPVMFDYFHLSVISVAIHAALVALQQPLI--------SFTRPGRGS--W-LG 192

  Fly   258 KLSCRGNTSPGP------LEAVFFGPQIGGTTKCSGG---PAGRLLQ-SRAIHREICSLLLGAIE 312
            |    |....||      ||.:.||......|...|.   |:...:| :...||::|.|||.|..
  Rat   193 K----GGPDTGPEQPTISLENLVFGAGYCKPTTSEGSFYVPSENCIQHAHKWHRDVCLLLLHAYR 253

  Fly   313 QLKATLNEFSTVLP--PSINSQIGSPPLRENDTGERLQLLLDQAKQLEAEEDFAIRANSDIAQLC 375
            .|:.........:|  |::..::.:       ..|.|..|..:.:.|...|..|.:.:.|:|.|.
  Rat   254 GLRLYFLVIMRDIPELPTMELEVLA-------VEETLSQLCSELQMLNNPEKIAEQISKDLAWLA 311

  Fly   376 AESIFWWRRVLLASRSSTAVHTLLARKHHILRVRRFAEGFFVLEQPRHAAAAGCPDQTNGSPSPG 440
            :..:..|.:.|......:.|.|.|.::||.||||||:|.||.:|   |...|....|.|      
  Rat   312 SHLMALWTQFLDTVTLHSHVTTYLTQEHHTLRVRRFSEAFFYME---HQKLAVLTFQEN------ 367

  Fly   441 HCQGYVAIAELARRSRYLQSLPPLPVHCTPIDGDASSLPLIFEDRYVTTNSTYARRRSGSDPQLE 505
            ..|.:..::...|.|.||.|:||||..|..||||.::||:|||||||                  
  Rat   368 LIQTHSQLSMDIRNSEYLTSMPPLPAECLDIDGDWNTLPVIFEDRYV------------------ 414

  Fly   506 DAVSVVGVQKKKVDKTHSSSSLNGIKDC------LACHFDYDYPQTNGSGPA----HPHAKCVIT 560
                                      ||      |:.:.:::.|.|:   ||    ....|.||.
  Rat   415 --------------------------DCPVSGHNLSVYPNFEVPVTS---PAIMKLKGKEKSVIN 450

  Fly   561 PRFALGGEVLQASLTIAPSKEAAPEAVAPPTLRHNLSRHSVTGLLEDLDLDSSLPARHSKSLDQL 625
            .:.:...|. ..|.|.||...:..:.:..|.:..|:|                            
  Rat   451 QKSSSRKEA-PLSTTEAPELGSDEDVIQCPEMEENVS---------------------------- 486

  Fly   626 DGCEGLATNPVSTTNNHTLPRLQADDLMRNICEFRQRY---GKFDYLHEIKLLNPPKQQQQAVPQ 687
                  ..||:                  ::|...|.|   |:|             |.:..:| 
  Rat   487 ------TQNPM------------------DVCSESQVYLSIGEF-------------QNRAGIP- 513

  Fly   688 QQQQCNNG------YNSLPKSMVPPRNSYPPPPPSQHTTM-----PRSSSSQIPRAVEIARVRVS 741
             :.:|..|      .:||....:..|:   |.|...||..     ..||:...|||..:..:.|.
  Rat   514 -EDECWTGPRPDAVKDSLTDVDICRRS---PGPEEGHTPALTYIDVESSNKNYPRAEPVLGLNVQ 574

  Fly   742 DIKEMLRQGQLRKESSSSESDMMQKLQMLSSNSVPFRLEGTSNNNTTS----------------- 789
                  .:.:..::|......|..|:           |.|.|.||:.|                 
  Rat   575 ------HEPRGSRDSYGIVKTMPSKV-----------LAGISQNNSISVNQTAALELRTLGRGVG 622

  Fly   790 -----------------SDPNTSGFSESL---PNLAPPPEFDSDSQLRRQRSNSTSSLSEESG-- 832
                             .||.::|..|:|   |:|..|.|...|..:.......::|:..:||  
  Rat   623 QEGKPVLLSLKLTPAEPCDPLSTGLREALDTKPSLPDPGEEPEDLSVLSGVIKRSASIISDSGIE 687

  Fly   833 -------WVSSRRSSLAISSPDTITSTGMTNRQR--------HTQLNLGMGMAMETRLNG----- 877
                   |..:|..:|.|.|...|....:.....        ||:.|..:..|::..|:.     
  Rat   688 SEPSSVAWSEARSRALEIPSDRDILHQVVRRHAHHRNSLEGGHTESNTSLPSAIQASLSSISSLP 752

  Fly   878 ---EQLRLRLQKVLEQQQLQQ-QHPHKNR------KRQAG------------TSSQSRTPAR--- 917
               |:..|.|.|:.:.....| ..|....      |..||            :||:..:|:.   
  Rat   753 FEDEERELALTKLTKSVSAPQISSPEDTAEDSDTIKNTAGFSEDLDLSSKDNSSSRYSSPSYSGS 817

  Fly   918 --QQTEVHKKISSVTVNIKRERSRYQLD-------------------RLRHLPNGES-------- 953
              |.......::.:.|...|.:....:|                   ...::|:.|:        
  Rat   818 RVQDVRAGHSLADIAVASDRPQGPGYMDIHKGNENHPDLQGPCCLDAMAENIPHVETKGLNLKIP 882

  Fly   954 -TEVEEMEPPPRRNRHKTACEKSKSDFDITSLKDMQPLDAVCLPPPQQFQDQEQELAL---VLAP 1014
             |.|  :|.|..|:.|:||.|.:|.                          :.:||:|   :|:.
  Rat   883 CTTV--LENPKTRSFHRTAVETAKG--------------------------KAKELSLSKHMLSN 919

  Fly  1015 PPPDEFRDPPPEPAPAAPIAPVPPPAAALPPTG----------KTKIVACHLPPPLKERQPIGAI 1069
            ....|.|.......|....||. ..|..|..||          ...:...|...| :.:...|.:
  Rat   920 NSISEVRAASHHRVPEISCAPA-VGAGHLHSTGVQNGSLSVNDTMTLNRRHNASP-EAKHEAGTV 982

  Fly  1070 DNPVYHIYESLRPISTPAIFSNKPVLKSHSLAELKRPQNLPNHSINHHCKTHA-----------I 1123
            ...|.|...|             ||.::.   |||...::....:|   .|.|           :
  Rat   983 CPTVTHTIAS-------------PVSRNQ---ELKAGTSISGSHLN---STEAFTLDSLKAVEVV 1028

  Fly  1124 NANGNVLENGLDHEQDEIKENSNGQVRTNKQGHGSNTNSKHKRKGQLASAVQEAPPSIS--LLEF 1186
            |.:.:.....|...... ||.......::||.....|:......|.:::...|....:|  :..|
  Rat  1029 NLSVSCTATCLPFSSVP-KETPARAGLSSKQSPAPITHQPLGSFGVVSTYSSELEEEVSERMFSF 1092

  Fly  1187 EKYREEFRKQIKYQGSIYSDYVQLASELPYFYISDEYRAFSPNGMHLVICVHGLDGNSADLRLVR 1251
            .:.:|:|:|::|.:|.:|||...|||::|||...:|..... :|:|||:|||||||||||||||:
  Rat  1093 YQAKEKFKKELKIEGFLYSDLSVLASDIPYFPPEEEEENLE-DGIHLVVCVHGLDGNSADLRLVK 1156

  Fly  1252 TYLELGLPGVNLEFLMSERNQGDTFSDFDTMTDRLVTEILYHIDSCALNPARISFVAHSLGTIIV 1316
            |::||||||..|:|||||:||.|||:|||||||||:.||:.||....|:.:||||:.||||.||:
  Rat  1157 TFIELGLPGGKLDFLMSEKNQMDTFADFDTMTDRLLDEIIQHIQLYNLSISRISFIGHSLGNIII 1221

  Fly  1317 RSALARPQMRPLLPRLHTFLSLSGPHLGTLYNTSGLVNMGMWFMQKWKKSGSLLQLCMRDTTDMR 1381
            ||.|.||:.|..|.:|||||||||||||||||.|.||:.|:|.|||.|||||||||..||..|:|
  Rat  1222 RSVLTRPRFRYYLNKLHTFLSLSGPHLGTLYNNSTLVSTGLWLMQKLKKSGSLLQLTFRDNADLR 1286

  Fly  1382 NSFLYRLSQRSTLHHFKNILLCGSSQDRYVPAHSARLELCKAAMRDSSSLGTIYREMVHNIIAPI 1446
            ..|||:|||::.|.:|||::|..|.||||||.||||:|:||.|::|..: |.:|.||::|::.|:
  Rat  1287 KCFLYQLSQKTGLQYFKNVVLVASPQDRYVPFHSARIEMCKTALKDRHT-GPVYAEMINNLLGPL 1350

  Fly  1447 LARPELTLARFDVHHALPHTANTLIGRAAHIAVLDSELFIEKFMLIAGLKYF 1498
            :...:.||.|.:|.||||:||||||||||||||||||||:|||.|:|||.||
  Rat  1351 VEAKDCTLIRHNVFHALPNTANTLIGRAAHIAVLDSELFLEKFFLVAGLNYF 1402

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32333NP_001261246.1 DUF3657 150..226 CDD:289180 30/78 (38%)
MhpC 1223..>1447 CDD:223669 139/224 (62%)
DUF676 1227..1422 CDD:282860 130/195 (67%)
Fam135bXP_001072719.2 DUF3657 111..170 CDD:289180 29/77 (38%)
DUF676 1133..1327 CDD:282860 130/195 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113117618
eggNOG 1 0.900 E1_KOG2205
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 627 1.000 Inparanoid score I799
OMA 1 1.010
OrthoDB 1 1.010 D1132320at2759
OrthoFinder 1 1.000 FOG0001201
OrthoInspector 1 1.000 T617582
orthoMCL 1 0.900 OOG5_129686
Panther 1 1.100 LDO PTHR12482
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.