DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mwh and LOC103909278

DIOPT Version :8

Sequence 1:NP_001261244.1 Gene:mwh / 38131 FlyBaseID:FBgn0264272 Length:1069 Species:Drosophila melanogaster
Sequence 2:XP_021323865.1 Gene:LOC103909278 / 103909278 -ID:- Length:238 Species:Danio rerio

Alignment Length:156 Identity:33/157 (21%)
Similarity:59/157 (38%) Gaps:40/157 (25%)


  Fly   684 GTQQQSKFKPVESSHQPVALPRQVPPPKKNKQNSSEHEDEGISSSETGASLSPVP---ILILPSK 745
            |.:...|.|.|:|....::|...:      ......|.|:   ::.|..|:.|:|   .:.|.|:
Zfish    25 GLEILPKLKDVKSRENHISLLDYI------VSYYLHHLDK---NAGTEKSIFPLPEPQDVFLSSQ 80

  Fly   746 ------AKPSRK------VVEEDEDDAAT------IEDVIEELDNIVSEAEKQISSQTSSVTRPK 792
                  :|..||      |.|:|.....|      |....|::|..::.|:|::.:....|...:
Zfish    81 VKFDDLSKDLRKLGRDLTVCEKDVLTVCTNSSQEHIHPFQEKMDFFIASAQKELITMEHQVVSAR 145

  Fly   793 MRHH----------RPVEKEIVPVNI 808
            ....          |..|:|:||.|:
Zfish   146 KSFSDLVEYFGLKPRSGEQEVVPGNV 171

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mwhNP_001261244.1 Drf_GBD <380..506 CDD:283920
Drf_FH3 524..725 CDD:283917 8/41 (20%)
LOC103909278XP_021323865.1 FH2 <1..183 CDD:302999 33/157 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000448
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.