DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and LYZL1

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_005252684.1 Gene:LYZL1 HGNCID:30502 Length:185 Species:Homo sapiens

Alignment Length:130 Identity:47/131 (36%)
Similarity:73/131 (56%) Gaps:8/131 (6%)


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPR---DQLAKWTCIAQHESSFRTGVVGPA 62
            |||..::..:.......:::...||.||:..|:.|:..   ..|..|.|:|.:||.:.| .....
Human    47 MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNT-TAQTV 110

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRF-SYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAWS 125
            ..:||.||||||||:..||:  .|:. ..|.|.::|:||:|||:|:::.|||||.:: ||...||
Human   111 LDDGSIDYGIFQINSFAWCR--RGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWS 173

  Fly   126  125
            Human   174  173

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/112 (39%)
LYZL1XP_005252684.1 LYZ1 66..172 CDD:238066 42/109 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48248093
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130075
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4912
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.