DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and 9530003J23Rik

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_084182.2 Gene:9530003J23Rik MGIID:1924647 Length:151 Species:Mus musculus

Alignment Length:137 Identity:55/138 (40%)
Similarity:78/138 (57%) Gaps:7/138 (5%)


  Fly     1 MKA--FLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVG 60
            |||  .|:...|.|.::..|.:..|||||||.:..||:...|   ||.|.|:|:.||:|.|....
Mouse     1 MKAPLTLLTLGLLLLSITIQGKVYDRCSLARTLQSLGLAGFQGITLANWVCLAKWESNFNTNTTR 65

  Fly    61 PANSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAW 124
            ....:.|..|||||||:::||.......|.|.|.:||.|||..:|.::|.||::|.:. ||..:|
Mouse    66 FNPEDQSTSYGIFQINSRFWCNDGKTPGSRNFCRISCKALLKSNIWSAVVCAKRIVKDPQGIYSW 130

  Fly   125 STW-KYC 130
            :.| |:|
Mouse   131 AGWIKHC 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 48/117 (41%)
9530003J23RikNP_084182.2 LYZ1 22..147 CDD:238066 48/117 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47789774
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130855
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 1 0.910 0.606 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4912
TreeFam 00.000 Not matched by this tool.
1110.940

Return to query results.
Submit another query.