DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and Lyzl6

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001343401.1 Gene:Lyzl6 MGIID:1916694 Length:148 Species:Mus musculus

Alignment Length:137 Identity:51/138 (37%)
Similarity:69/138 (50%) Gaps:8/138 (6%)


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAR---EMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPA 62
            :|| |.||..:...|......:.|||||:   |....|.....|..|.|:|..||:|....|. .
Mouse     2 LKA-LFICVASCLLVVNDGNIIHRCSLAKILYEEDLDGFEGYSLPDWLCLAFVESNFNISKVN-E 64

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWST 126
            |.:||.||||||||::|||...... |.|.|.:.|..||:.::.:::.||:|| ....|...|..
Mouse    65 NVDGSFDYGIFQINSRYWCNDYQSH-SENFCHVDCQELLSPNLISTIHCAKKIVSGPGGMKNWVE 128

  Fly   127 WK-YCSG 132
            || :|.|
Mouse   129 WKLHCLG 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 45/119 (38%)
Lyzl6NP_001343401.1 LYZ1 21..142 CDD:238066 45/118 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48472715
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130855
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.