DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and LYZ

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_000230.1 Gene:LYZ HGNCID:6740 Length:148 Species:Homo sapiens

Alignment Length:132 Identity:54/133 (41%)
Similarity:78/133 (59%) Gaps:5/133 (4%)


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPA 62
            ||| |::..|.|.:|..|.:..:||.|||.:.:||:...:   ||.|.|:|:.||.:.|......
Human     1 MKA-LIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYN 64

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQ-QGWTAWST 126
            ..:.|.||||||||::|||.......:.|.|.|||:|||.|:|.::|.||:::.|. ||..||..
Human    65 AGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVA 129

  Fly   127 WK 128
            |:
Human   130 WR 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 46/114 (40%)
LYZNP_000230.1 LYZ1 19..147 CDD:197612 46/114 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C47797669
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4766
Isobase 1 0.950 0 Normalized mean entropy S6481
OMA 1 1.010
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130075
orthoMCL 1 0.900 OOG5_132524
Panther 1 1.100 O PTHR11407
Phylome 1 0.910 0.606 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4912
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.