DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and SPACA5

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_995328.2 Gene:SPACA5 HGNCID:31353 Length:159 Species:Homo sapiens

Alignment Length:143 Identity:50/144 (35%)
Similarity:81/144 (56%) Gaps:17/144 (12%)


  Fly     1 MKAF--LVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVG 60
            |||:  :|:...||..|...|:..:||.||..:.:.|:...:   :..|.|:|.:||.|.|..| 
Human     1 MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFV- 64

  Fly    61 PANSNGSNDYGIFQINNKYWC----KPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQG 120
            ..|.:||::|||||:|:.:||    .|     :.|.|.:.|:.||...|.:.::||::| ..|.|
Human    65 DHNPDGSSEYGIFQLNSAWWCDNGITP-----TKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNG 124

  Fly   121 WTAWSTWK-YCSG 132
            .:||::|: :|||
Human   125 LSAWTSWRLHCSG 137

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 42/123 (34%)
SPACA5NP_995328.2 LYZ1 22..145 CDD:238066 42/123 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48394292
eggNOG 1 0.900 E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.