DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and Lyzl4

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_006244185.2 Gene:Lyzl4 RGDID:1308401 Length:370 Species:Rattus norvegicus

Alignment Length:131 Identity:41/132 (31%)
Similarity:70/132 (53%) Gaps:9/132 (7%)


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPA 62
            |:.:||:..::.......|..:.||.:|:::...|:...:   |..|.|:|..||.|....|...
  Rat   226 MQLYLVLLLISYLLTPIGASILGRCVVAKKLYDGGLNYFEGYSLENWVCLAYFESKFNPSAVYEN 290

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQR-QQGWTAWST 126
            :.:||..:|:|||.:..||.  .|:   |.|.:||.|||..::.::::||:||.: :||..||..
  Rat   291 SRDGSTGFGLFQIRDNEWCD--HGK---NLCSVSCTALLNPNLKDTIECAKKIVKGKQGMGAWPV 350

  Fly   127 W 127
            |
  Rat   351 W 351

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 37/113 (33%)
Lyzl4XP_006244185.2 LYZ1 246..366 CDD:238066 37/112 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48155779
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.