DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and Spaca3

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001099290.1 Gene:Spaca3 RGDID:1306684 Length:163 Species:Rattus norvegicus

Alignment Length:137 Identity:49/138 (36%)
Similarity:75/138 (54%) Gaps:15/138 (11%)


  Fly     3 AFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPANS 64
            |:|:.|.|    .:::|:...||.||:.:...|:...:   ||.|.|:|.:.|.|.|..| ...:
  Rat    23 AYLLSCLL----ASSKAKVFSRCELAKVLHDFGLEGYRGYNLADWICLAYYTSGFNTDAV-DHEA 82

  Fly    65 NGSNDYGIFQINNKYWCK--PADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWST 126
            :||.:.|||||:::.|||  ..:|.   |.|.:.|..||::|:.:||.|..|| |..||...|.:
  Rat    83 DGSTNNGIFQISSRKWCKNLAPNGP---NLCRIYCTDLLSNDLKDSVACVMKIAQEPQGLGYWES 144

  Fly   127 WK-YCSG 132
            || :|.|
  Rat   145 WKHHCQG 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 44/121 (36%)
Spaca3NP_001099290.1 LYZ1 36..159 CDD:238066 44/121 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48319736
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T131092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.940

Return to query results.
Submit another query.