DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and CG30062

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_725299.2 Gene:CG30062 FlyBaseID:FBgn0050062 Length:171 Species:Drosophila melanogaster

Alignment Length:135 Identity:64/136 (47%)
Similarity:95/136 (70%) Gaps:8/136 (6%)


  Fly    10 LTLTAVATQARTMDRCSLAREMSKLGVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSNDYGIFQ 74
            :.|.|:..|.     |.||.::..|.||:.:|..|.|||:.||.|.|.|||.||::||.|||:||
  Fly    22 IPLLAIRLQP-----CELAGQLYILDVPKSELPLWLCIAEFESRFNTHVVGQANADGSRDYGLFQ 81

  Fly    75 INNKYWCKPADGR--FSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTW-KYCSGSLPS 136
            |:::|||.|.:..  :::|:|.::|..||:||||.:|:|||.||:||||||||.: ::|:|:|.:
  Fly    82 ISDRYWCAPPNRTEYYAFNDCNVNCTHLLSDDITMAVQCARLIQKQQGWTAWSVYPEFCNGTLDA 146

  Fly   137 INSCF 141
            |:.||
  Fly   147 IDVCF 151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 60/124 (48%)
CG30062NP_725299.2 lysozyme_like 32..150 CDD:294153 59/118 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130907500
eggNOG 1 0.900 E1_2BPI7
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11407
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.