DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and Lalba

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_034809.1 Gene:Lalba MGIID:96742 Length:143 Species:Mus musculus

Alignment Length:131 Identity:46/132 (35%)
Similarity:75/132 (57%) Gaps:6/132 (5%)


  Fly     6 VICALTLTAVATQARTMDRCSLAREMSKL-GVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSND 69
            ::|.|:|.|.  ||..:.:|.::..:..: |.....|.:|.|:..|.|.:.|..|  .|.|||.:
Mouse     9 LVCILSLPAF--QATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAV--VNDNGSTE 69

  Fly    70 YGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTWK-YCSGS 133
            ||:|||::::|||.::...|.|.||:||:.||.|::.:.:.||:||...:|...|..:| .||..
Mouse    70 YGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEK 134

  Fly   134 L 134
            |
Mouse   135 L 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 40/118 (34%)
LalbaNP_034809.1 Lys 21..138 CDD:278491 40/118 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48039010
eggNOG 1 0.900 E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.900

Return to query results.
Submit another query.