powered by:
                   
 
    
    
             
          
            Protein Alignment LysP and Lalba
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_476828.1 | Gene: | LysP / 38129 | FlyBaseID: | FBgn0004429 | Length: | 141 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_034809.1 | Gene: | Lalba / 16770 | MGIID: | 96742 | Length: | 143 | Species: | Mus musculus | 
        
        
        
          
            | Alignment Length: | 131 | Identity: | 46/131 - (35%) | 
          
            | Similarity: | 75/131 -  (57%) | Gaps: | 6/131 - (4%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     6 VICALTLTAVATQARTMDRCSLAREMSKL-GVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSND 69::|.|:|.|.  ||..:.:|.::..:..: |.....|.:|.|:..|.|.:.|..|  .|.|||.:
 Mouse     9 LVCILSLPAF--QATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAV--VNDNGSTE 69
 
 
  Fly    70 YGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTWK-YCSGS 133||:|||::::|||.::...|.|.||:||:.||.|::.:.:.||:||...:|...|..:| .||..
 Mouse    70 YGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEK 134
 
 
  Fly   134 L 134|
 Mouse   135 L 135
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
          
          
            | Gene | Sequence | Domain | Region | External ID | Identity | 
          
            | LysP | NP_476828.1 | LYZ1 | 20..141 | CDD:197612 | 40/117 (34%) | 
          
            | Lalba | NP_034809.1 | Lys | 21..138 | CDD:333808 | 40/117 (34%) | 
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C167844191 | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_2BPI7 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 1 | 1.010 | - | - |  | D1551203at2759 | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | O | PTHR11407 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 1 | 0.960 | - | - |  |  | 
          
            |  | 6 | 5.810 |  | 
        
      
           
             Return to query results.
             Submit another query.