DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysP and Lalba

DIOPT Version :9

Sequence 1:NP_476828.1 Gene:LysP / 38129 FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_034809.1 Gene:Lalba / 16770 MGIID:96742 Length:143 Species:Mus musculus


Alignment Length:131 Identity:46/131 - (35%)
Similarity:75/131 - (57%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VICALTLTAVATQARTMDRCSLAREMSKL-GVPRDQLAKWTCIAQHESSFRTGVVGPANSNGSND 69
            ::|.|:|.|.  ||..:.:|.::..:..: |.....|.:|.|:..|.|.:.|..|  .|.|||.:
Mouse     9 LVCILSLPAF--QATELTKCKVSHAIKDIDGYQGISLLEWACVLFHTSGYDTQAV--VNDNGSTE 69

  Fly    70 YGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQRQQGWTAWSTWK-YCSGS 133
            ||:|||::::|||.::...|.|.||:||:.||.|::.:.:.||:||...:|...|..:| .||..
Mouse    70 YGLFQISDRFWCKSSEFPESENICGISCDKLLDDELDDDIACAKKILAIKGIDYWKAYKPMCSEK 134

  Fly   134 L 134
            |
Mouse   135 L 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 40/117 (34%)
LalbaNP_034809.1 Lys 21..138 CDD:333808 40/117 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844191
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BPI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.810

Return to query results.
Submit another query.