DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and LYZL4

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001291315.1 Gene:LYZL4 HGNCID:28387 Length:146 Species:Homo sapiens

Alignment Length:138 Identity:44/139 (32%)
Similarity:71/139 (51%) Gaps:9/139 (6%)


  Fly     1 MKAFLVICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPA 62
            |||.:|:..|....|.:.|..:.||::|:::...|:...:   |..|.|:|..||.|....:...
Human     1 MKASVVLSLLGYLVVPSGAYILGRCTVAKKLHDGGLDYFEGYSLENWVCLAYFESKFNPMAIYEN 65

  Fly    63 NSNGSNDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKIQR-QQGWTAWST 126
            ...|...:|:||:....||    |....|.|.:||:|||..::..::|||:.|.: ::|..||.|
Human    66 TREGYTGFGLFQMRGSDWC----GDHGRNRCHMSCSALLNPNLEKTIKCAKTIVKGKEGMGAWPT 126

  Fly   127 W-KYCSGS 133
            | :||..|
Human   127 WSRYCQYS 134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 37/120 (31%)
LYZL4NP_001291315.1 LYZ1 20..142 CDD:238066 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48155281
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T130075
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.