DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LysP and SPACA3

Sequence 1:NP_476828.1 Gene:LysP FlyBaseID:FBgn0004429 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_776246.1 Gene:SPACA3 HGNCID:16260 Length:215 Species:Homo sapiens

Alignment Length:132 Identity:43/133 (32%)
Similarity:68/133 (51%) Gaps:7/133 (5%)


  Fly     6 VICALTLTAVATQARTMDRCSLAREMSKLGVPRDQ---LAKWTCIAQHESSFRTGVVGPANSNGS 67
            ::|.|:....:::|:...||.|||.:...|:...:   ||.|.|:|...|.|....: ...::||
Human    74 LVCLLSCLLPSSEAKLYGRCELARVLHDFGLDGYRGYSLADWVCLAYFTSGFNAAAL-DYEADGS 137

  Fly    68 NDYGIFQINNKYWCKPADGRFSYNECGLSCNALLTDDITNSVKCARKI-QRQQGWTAWSTWK-YC 130
            .:.||||||::.||........ |.|.:.|:.||..::.::|.||.|| |..||...|..|: :|
Human   138 TNNGIFQINSRRWCSNLTPNVP-NVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHC 201

  Fly   131 SG 132
            .|
Human   202 QG 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysPNP_476828.1 LYZ1 20..141 CDD:197612 40/119 (34%)
SPACA3NP_776246.1 LYZ1 88..211 CDD:238066 40/119 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48319265
eggNOG 1 0.900 E1_2BPI7
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130075
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4912
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.