DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lyzl1

DIOPT Version :9

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_080368.1 Gene:Lyzl1 / 67328 MGIID:1914578 Length:148 Species:Mus musculus


Alignment Length:129 Identity:45/129 - (34%)
Similarity:74/129 - (57%) Gaps:12/129 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIVLVALALAAPALGRTMDRCSLAREMSNLGVPR---DQLARWACIAEHESSYRTGVVGPENY-- 63
            |.::::.::.|.:  :...||.||:..:..|:..   ..|..|.|:|.:||.|.|..   ||.  
Mouse     7 FALIISFSIVAES--KIYTRCKLAKIFAKAGLDNYGGFALGNWLCMAYYESHYNTTA---ENVLE 66

  Fly    64 NGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAWSTW 126
            :||.||||||||.:.||. .:.:...|.|.::|:||:|||:|.::.||:|::.: ||.:.|..|
Mouse    67 DGSTDYGIFQINSFTWCR-NARKHQKNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 43/114 (38%)
Lyzl1NP_080368.1 LYZ1 20..143 CDD:238066 43/114 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844194
Domainoid 1 1.000 108 1.000 Domainoid score I6421
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46733
OrthoDB 1 1.010 - - D1551203at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8677
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11407
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X173
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.010

Return to query results.
Submit another query.