DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LysB and Lyzl1

DIOPT Version :8

Sequence 1:NP_001261245.1 Gene:LysB / 38125 FlyBaseID:FBgn0004425 Length:140 Species:Drosophila melanogaster
Sequence 2:NP_080368.1 Gene:Lyzl1 / 67328 MGIID:1914578 Length:148 Species:Mus musculus

Alignment Length:129 Identity:45/130 (35%)
Similarity:74/130 (57%) Gaps:12/130 (9%)


  Fly     4 FIVLVALALAAPALGRTMDRCSLAREMSNLGVPR---DQLARWACIAEHESSYRTGVVGPENY-- 63
            |.::::.::.|.:  :...||.||:..:..|:..   ..|..|.|:|.:||.|.|..   ||.  
Mouse     7 FALIISFSIVAES--KIYTRCKLAKIFAKAGLDNYGGFALGNWLCMAYYESHYNTTA---ENVLE 66

  Fly    64 NGSNDYGIFQINDYYWCAPPSGRFSYNECGLSCNALLTDDITHSVRCAQKVLSQ-QGWSAWSTW 126
            :||.||||||||.:.||. .:.:...|.|.::|:||:|||:|.::.||:|::.: ||.:.|..|
Mouse    67 DGSTDYGIFQINSFTWCR-NARKHQKNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGW 129

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LysBNP_001261245.1 Lys 19..139 CDD:278491 43/115 (37%)
Lyzl1NP_080368.1 LYZ1 20..143 CDD:238066 43/115 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48246667
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4801
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1551203at2759
OrthoFinder 1 1.000 FOG0000203
OrthoInspector 1 1.000 T130855
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11407
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.