DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and c11orf54

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001016346.2 Gene:c11orf54 XenbaseID:XB-GENE-1010634 Length:316 Species:Xenopus tropicalis

Alignment Length:313 Identity:144/314 (46%)
Similarity:196/314 (62%) Gaps:5/314 (2%)


  Fly    14 EEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFL 78
            |....:||.|.|:.:|::..|..|||:|:|.|..||||..:.|.....||.||..:.:.||.|:|
 Frog     5 ENCSFHVPSLEEICSVLKSGLLKNFADVSVIVTECPDLSKEPFEFPVKGLCGKSRIADVGGVPYL 69

  Fly    79 LPLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSV-NEKDELTNGSYTAT 142
            :|..:.||:||:..:.:||..|| .:.:||||......|.|.|.||::.. ||..:..|.||.|:
 Frog    70 VPKPRLDKVYNVNAVAKKIGLPG-AYILGAGATSHKSLGMNAELIFSVQAENESIQAVNKSYVAS 133

  Fly   143 VRGEQEECVLEKI--PHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYG 205
            |......|:|||.  .:.:....||.||:..:||||:|::::.|:|.|:.||:.|:||.|:.|||
 Frog   134 VNPGDGSCLLEKYRDRNNDNDFGLLSNLYACEGKPGKVIEVSVKRRIGQDNFVSCMRKSLKTHYG 198

  Fly   206 DKVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDL 269
            :|.|||||.||:|:|.|..||| |::|..|:|:||:||.|||||||.|.|......|:.:...||
 Frog   199 EKAVGLGGTFLLKEGKAKLHVMPREYSACPLNTDEDVNGWLKFYEMKAPLICQSVFVSHDPGYDL 263

  Fly   270 RLQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            ||:|.|.||....|||||||||||.|||..|.:.||.:.|:|||.|||.||||
 Frog   264 RLEHTHCFSHHGEGGHYHYDTTPDTVEYLGYFHPAELLYRIDKPSATHMVGRD 316

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 128/283 (45%)
c11orf54NP_001016346.2 DUF1907 22..304 CDD:286069 128/283 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344146227
eggNOG 1 0.900 E1_KOG4048
Hieranoid 1 1.000
Homologene 1 1.000 H8531
Inparanoid 1 1.050 276 1.000 Inparanoid score I2750
OMA 1 1.010
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
OrthoInspector 1 1.000 T601283
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3978
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.