DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and RGD1309534

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014228.1 Gene:RGD1309534 RGDID:1309534 Length:315 Species:Rattus norvegicus

Alignment Length:312 Identity:150/313 (48%)
Similarity:199/313 (64%) Gaps:5/313 (2%)


  Fly    15 EKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLL 79
            |...:||.|.||..|:|..|..|||:|.|||..||||..:.|.....|:.|:..:.|.||.|:||
  Rat     5 EFSFHVPSLEELAEVLQKGLKDNFAHVQVSVVDCPDLTKEPFTFPVKGICGQTRIAEVGGVPYLL 69

  Fly    80 PLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGI-FNLSVNEKDELTNGSYTATV 143
            |||.:.|:|::.||.::|:.|| .|.:||||||:...|.|.|.: ...:.:|..:..||||.|..
  Rat    70 PLVNKKKVYDLNEIAKEIKLPG-AFILGAGAGPFQTLGFNSEFMPIVQTASEHHQPVNGSYFARA 133

  Fly   144 RGEQEECVLEKIPHTEP--RCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHYGD 206
            .....:|:|||.....|  .||||.|||.|:|:||:|:::.||:||||.||:.|:|:.||.||||
  Rat   134 NPADGKCLLEKYSQKYPDFGCALLANLFASEGQPGKVIEVQAKKRTGEHNFVSCMRQTLEKHYGD 198

  Fly   207 KVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDLR 270
            |.||:||.||::||....|:| .:||...:||||.||:||.||||.|.|..:...|:|:..||||
  Rat   199 KPVGMGGTFLVQKGKVKAHIMPAEFSSCSLNSDEAVNQWLNFYEMKAPLVCLPVFVSKDPGLDLR 263

  Fly   271 LQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            |:|.|.||....|||||||||||.|||..|.:.|:.:.|:|:|..||..|||
  Rat   264 LEHTHFFSHHGEGGHYHYDTTPDTVEYLGYFSPAQFLYRIDQPKETHAFGRD 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 136/283 (48%)
RGD1309534NP_001014228.1 DUF1907 21..303 CDD:286069 136/283 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344146515
eggNOG 1 0.900 E1_KOG4048
Hieranoid 1 1.000
Homologene 1 1.000 H8531
Inparanoid 1 1.050 287 1.000 Inparanoid score I2705
OMA 1 1.010
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
OrthoInspector 1 1.000 T618345
orthoMCL 1 0.900 OOG5_132834
Panther 1 1.100 LDO PTHR13204
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.