DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and zgc:85789

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_997781.1 Gene:zgc:85789 ZFINID:ZDB-GENE-030131-1069 Length:319 Species:Danio rerio

Alignment Length:314 Identity:135/315 (43%)
Similarity:197/315 (63%) Gaps:7/315 (2%)


  Fly    14 EEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFL 78
            |:..|:||.|.||..|::..|..||::|.|||..||||..:.||....||.|||.:.:.||.|.|
Zfish     8 EKFQLHVPNLEELCQVLESGLNKNFSDVKVSVTDCPDLTQQPFGFPVKGLCGKPRITDVGGVPNL 72

  Fly    79 LPLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSVNEKD--ELTNGSYTA 141
            :|||:.||:||:..::::::.|| .|.:||||..:...|.|.| :..|.:.|.:  ...|.||.:
Zfish    73 IPLVKLDKVYNMNSVSKEVELPG-AFILGAGAISFKTAGINGE-LMPLVLTEAEGRSAVNASYFS 135

  Fly   142 TVRGEQEECVLEKIPHTEPRC--ALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHY 204
            ::..|..:|:.||.......|  .||.||:..:||||:|:::.|.:||||.:.:.|:||.:..||
Zfish   136 SINPEDGKCLQEKYSDRFDDCDFGLLANLYACEGKPGKVIEVKACRRTGEDSLVSCMRKTMAEHY 200

  Fly   205 GDKVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLD 268
            |:|.|.|||.|:|:||.|..|:| |:||..|:|:||:||.||:.:|:.|.|.....:::::..||
Zfish   201 GEKSVALGGTFIIQKGKAKIHIMPREFSVCPLNTDEDVNNWLRHFEVSAPLIFQTVMISRDPGLD 265

  Fly   269 LRLQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            ||::|.|.||....||||:.||||:.|||..|...||.|.|:|:|..||.||||
Zfish   266 LRVEHTHGFSHHGEGGHYYTDTTPNTVEYLGYFLPAETVYRIDRPTETHNVGRD 319

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 119/284 (42%)
zgc:85789NP_997781.1 DUF1907 25..307 CDD:286069 119/284 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344147300
eggNOG 1 0.900 E1_KOG4048
Hieranoid 1 1.000
Homologene 1 1.000 H8531
Inparanoid 1 1.050 257 1.000 Inparanoid score I3070
OMA 1 1.010
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
OrthoInspector 1 1.000 T597029
orthoMCL 1 0.900 OOG5_132834
Panther 1 1.100 LDO PTHR13204
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3978
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.