DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and C11orf54

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001272996.1 Gene:C11orf54 HGNCID:30204 Length:315 Species:Homo sapiens

Alignment Length:314 Identity:150/315 (48%)
Similarity:202/315 (64%) Gaps:9/315 (3%)


  Fly    15 EKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLL 79
            |...:||.|.||..|:|..|..|||:|.|||..||||..:.|.....|:.||..:.|.||.|:||
Human     5 EFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLL 69

  Fly    80 PLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSV-NEKDELTNGSYTATV 143
            |||.:.|:|::.:|.::|:.|| .|.:||||||:...|.|.|.:..:.. :|.....||||.|.|
Human    70 PLVNQKKVYDLNKIAKEIKLPG-AFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHV 133

  Fly   144 RGEQEECVLEKIPHTEP----RCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIECIRKGLENHY 204
            ......|:|||  ::|.    :||||.|||.|:|:||:|:::.||:|||..||:.|:|:.||.||
Human   134 NPADGGCLLEK--YSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHY 196

  Fly   205 GDKVVGLGGIFLIKKGAAHQHVM-RDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLD 268
            |:|.:|:||.|:|:||....|:| .:||..|:|||||||:||.||||.|.|..:...|:::...|
Human   197 GNKPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFD 261

  Fly   269 LRLQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            |||:|.|.||....|||||||||||||||..|...||.:.|:|:|..||.:|||
Human   262 LRLEHTHFFSRHGEGGHYHYDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 136/285 (48%)
C11orf54NP_001272996.1 DUF1907 21..303 CDD:312474 136/285 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344145963
eggNOG 1 0.900 E1_KOG4048
Hieranoid 1 1.000
Homologene 1 1.000 H8531
Inparanoid 1 1.050 282 1.000 Inparanoid score I2837
Isobase 1 0.950 0 Normalized mean entropy S3572
OMA 1 1.010
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
OrthoInspector 1 1.000 T609412
orthoMCL 1 0.900 OOG5_132834
Panther 1 1.100 LDO PTHR13204
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.720

Return to query results.
Submit another query.