DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and CG32335

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_728575.2 Gene:CG32335 FlyBaseID:FBgn0063667 Length:322 Species:Drosophila melanogaster

Alignment Length:322 Identity:247/323 (76%)
Similarity:284/323 (88%) Gaps:0/323 (0%)


  Fly     1 MSQNQLSTEQLLFEEKPLYVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGG 65
            |:.:.|.||||||||:||:|||||||:.||||||..||..|:|||..||||:..||||||.||||
  Fly     1 MNGSHLQTEQLLFEERPLHVPPLSELKRVIQGALDENFRTVDVSVEACPDLRDSQFGLVERGLGG 65

  Fly    66 KPTLLEAGGPPFLLPLVQRDKLYNIAEITRKIQGPGTVFAVGAGAGPWPIRGSNCEGIFNLSVNE 130
            |.|||||||||:|.||||||||||:.||||:.||.|.:||||.||||||||.||||||||.|:||
  Fly    66 KATLLEAGGPPYLRPLVQRDKLYNLKEITRRTQGAGKIFAVGPGAGPWPIRHSNCEGIFNFSLNE 130

  Fly   131 KDELTNGSYTATVRGEQEECVLEKIPHTEPRCALLLNLFLSQGKPGQVLKITAKQRTGEQNFIEC 195
            :||||.|||||||||..|:||||:||.||.|.||:||||||:|||||||:|:||||||.:||:||
  Fly   131 EDELTQGSYTATVRGANEDCVLERIPETESRAALILNLFLSEGKPGQVLRISAKQRTGGENFVEC 195

  Fly   196 IRKGLENHYGDKVVGLGGIFLIKKGAAHQHVMRDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTL 260
            ||||||.||||:||||||:|::::|..|||||||||||||::.|::..|||||||||||||||||
  Fly   196 IRKGLERHYGDQVVGLGGMFVVRRGCVHQHVMRDFSKTPIHTQEQIQNWLKFYEMPAQLNAVGTL 260

  Fly   261 VTKEHDLDLRLQHFHSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDKPVATHKVGRD 322
            |||:..|||||||||||||:|||||||||||||||||||||||||||:|||:||||.::|||
  Fly   261 VTKDMGLDLRLQHFHSFSFANWGGHYHYDTTPDIVEYEAYLNVAERVIRVDRPVATDQLGRD 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 217/279 (78%)
CG32335NP_728575.2 DUF1907 31..310 CDD:286069 217/279 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344138761
eggNOG 1 0.900 E1_KOG4048
Homologene 1 1.000 H8531
Inparanoid 1 1.050 199 1.000 Inparanoid score I2448
Isobase 1 0.950 0 Normalized mean entropy S3572
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
orthoMCL 1 0.900 OOG5_132834
Panther 1 1.100 P PTHR13204
RoundUp 00.000 Not matched by this tool.
98.840

Return to query results.
Submit another query.