DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9119 and C24B5.4

Sequence 1:NP_612081.1 Gene:CG9119 FlyBaseID:FBgn0035189 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_505382.2 Gene:C24B5.4 WormBaseID:WBGene00016046 Length:308 Species:Caenorhabditis elegans

Alignment Length:298 Identity:114/299 (38%)
Similarity:162/299 (54%) Gaps:12/299 (4%)


  Fly    19 YVPPLSELQNVIQGALAANFANVNVSVGPCPDLKAKQFGLVESGLGGKPTLLEAGGPPFLLPLVQ 83
            :||.|.||:.|.|.:|.:||.||.|::..||||....|....||.|....:.|.|||..|.|...
 Worm    15 HVPSLEELKMVFQTSLLSNFENVEVNIVDCPDLSKPPFNQKSSGFGHNLRIAEVGGPGNLYPGFH 79

  Fly    84 RDKLYNIAEITRKIQGP-GTVFAVGAGAGPWPIRGSNCEGI--FNLSVNEKDELTNGSYTATVRG 145
            .|..::|.:|.:..:.| ..||  |.|||||||.|.|||.:  .||...|.     |:..|.:..
 Worm    80 IDHQFDIPKIGKVCEHPEAAVF--GPGAGPWPIVGQNCEMVADVNLKTGEV-----GTRIAEINS 137

  Fly   146 EQEECVLEKIPHTEPRCALLLNLFLSQG-KPGQVLKITAKQRTGEQNFIECIRKGLENHYGDKVV 209
            ..::..:::| ..||:.:|:.||.||.. |...|:...|..|.||:|...|||.||:.|:|.|:|
 Worm   138 NSDKRYVQRI-IDEPKFSLMANLALSDADKSSTVVHFKASVRKGEKNLTNCIRDGLQEHFGKKIV 201

  Fly   210 GLGGIFLIKKGAAHQHVMRDFSKTPINSDEEVNEWLKFYEMPAQLNAVGTLVTKEHDLDLRLQHF 274
            .|.|.|:|:.|.|..|||.||...|..::.||::||.::||.|.|.....:.:.:...:|||:|.
 Worm   202 SLAGQFIIQTGKARLHVMPDFPGCPFENNAEVDKWLNYFEMSAPLICATVMHSYDPGHNLRLEHT 266

  Fly   275 HSFSFSNWGGHYHYDTTPDIVEYEAYLNVAERVVRVDK 312
            |.:|.....||||||.||:.|.||.:...|.::.|:|:
 Worm   267 HCYSDHGDAGHYHYDVTPETVSYEGWFAPASKIYRIDE 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9119NP_612081.1 DUF1907 31..310 CDD:286069 107/283 (38%)
C24B5.4NP_505382.2 DUF1907 27..302 CDD:286069 107/283 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C344138807
eggNOG 1 0.900 E1_KOG4048
Hieranoid 1 1.000
Homologene 1 1.000 H8531
Inparanoid 1 1.050 199 1.000 Inparanoid score I2448
Isobase 1 0.950 0 Normalized mean entropy S3572
OMA 1 1.010
OrthoDB 1 1.010 D375938at33208
OrthoFinder 1 1.000 FOG0005010
OrthoInspector 1 1.000 T375300
orthoMCL 1 0.900 OOG5_132834
Panther 1 1.100 LDO PTHR13204
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3978
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.