DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and AT5G19840

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001190341.1 Gene:AT5G19840 AraportID:AT5G19840 Length:549 Species:Arabidopsis thaliana

Alignment Length:300 Identity:74/300 (25%)
Similarity:121/300 (40%) Gaps:77/300 (26%)


  Fly   159 SNCDIPQL----DAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKW----LDLNYLLQVAG---- 211
            :.|:.|.:    :|.:..:|::.......|.:.......|.|..||    ..|:||.:.||    
plant     3 TGCEFPMIKTFENALTAADFESTVELTNFPAVFRGCASVWDAYSKWNPFNSGLDYLEERAGSVEV 67

  Fly   212 ----NRTVPIEIGSNYASDEWSQQLVKI--RDFLSRQFGKEPSKA---GQNIE------------ 255
                :||.|:     :..|..|.:.|.:  .||:  :|.|:..:.   |..::            
plant    68 EAMLSRTAPV-----FNGDIRSHERVSLPFSDFI--RFCKQHMRGKGNGSGVDAKSADLNPMCED 125

  Fly   256 ------YLAQHELF-------AQIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHY 307
                  ||||..:.       ..:..|::||..|.:.     |......|..|:..|...|..||
plant   126 YRPGQIYLAQFPILNDEKEEKVLLKILRQDIQTPTFL-----DAKSLSSINFWMNSAEARSSTHY 185

  Fly   308 DPKHNLLCQVFGSKRIILAAPADTDNLYP---------HDSEFLANTARIDAAQLDPETYPLV-- 361
            ||.|||||.|.|.|:::|..|:.:.:|||         |.|..|.|....|        ||..  
plant   186 DPHHNLLCVVSGRKKVVLWPPSASPSLYPMPIYGEASNHSSVGLENPNLSD--------YPRAEH 242

  Fly   362 AKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWWE 401
            :..:..::.|..||.:::|..|:|.|.|:..:.:|:|||:
plant   243 SLKQSQEITLNAGDAVFIPEGWFHQVDSDELTVAVNFWWQ 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/282 (25%)
AT5G19840NP_001190341.1 Cupin_8 19..285 CDD:290351 71/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.