DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and JMJD5

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_850617.1 Gene:JMJD5 AraportID:AT3G20810 Length:429 Species:Arabidopsis thaliana

Alignment Length:431 Identity:148/432 (34%)
Similarity:205/432 (47%) Gaps:63/432 (15%)


  Fly     1 MDSEFLELTQLLPRWVDLENVVRGEVEARYILKRAADHLANLRSGGDSGAEETGYLVGALVDRNW 65
            :|:|...|.|.:            ..|..|...|    :|.|...||..|.|      |..|..|
plant    22 LDAESQTLLQSI------------SAEGGYAYAR----MAVLAVAGDQSAAE------AARDMAW 64

  Fly    66 ERIHTGHFSQVPLVTRKIYAIACCF--KIFFL--------------LLESTSPAQKDACSEIL-- 112
            |::|:|.:..|..|.|..|::||..  ||.|.              |:......:||....:|  
plant    65 EQLHSGPWHSVLPVWRDAYSMACLHVAKIHFAAGEFGEALGALDMGLIMGGMLLRKDLHDSVLLV 129

  Fly   113 -DEAQLLGCMEDWSELKVALMDY----LDKDGAVALNSA--PLPTLEPLTRVTSNC------DIP 164
             .||:.:     ...|:.|..|:    |..:..|.:|..  .|..|:.|......|      .:.
plant   130 SSEARKM-----TKSLEEASGDFKGERLVPEVPVDVNEVRHVLANLQLLVLKILPCRSLTCKRVE 189

  Fly   165 QLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWS 229
            :....|||.|....:..|.|.::.|::.||||..||..|:||..||||||||:|:|.||...:|.
plant   190 KRSGLSLEGFLRDYYLPGTPVVITNSMAHWPARTKWNHLDYLNAVAGNRTVPVEVGKNYLCSDWK 254

  Fly   230 QQLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKA 294
            |:||....||.|.  :....:.....|||||.||.||..|::||.|||||.:...:..   .:.|
plant   255 QELVTFSKFLERM--RTNKSSPMEPTYLAQHPLFDQINELRDDICIPDYCFVGGGELQ---SLNA 314

  Fly   295 WLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYP 359
            |.||||||:|:|:||.||:|.||.|.|.|.|......|.|||:....|.|::::|...:|...:|
plant   315 WFGPAGTVTPLHHDPHHNILAQVVGKKYIRLYPSFLQDELYPYSETMLCNSSQVDLDNIDETEFP 379

  Fly   360 LVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 400
            ...:::|...:|:.|:.||:||||||||||...|.||||||
plant   380 KAMELEFMDCILEEGEMLYIPPKWWHYVRSLTMSLSVSFWW 420

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 102/230 (44%)
JMJD5NP_850617.1 Cupin_8 199..423 CDD:290351 100/224 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 223 1.000 Inparanoid score I1159
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoInspector 1 1.000 T193546
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 1 0.910 0.667 Consistency score
77.070

Return to query results.
Submit another query.