DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and KDM8

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001138820.1 Gene:KDM8 HGNCID:25840 Length:454 Species:Homo sapiens

Alignment Length:418 Identity:154/419 (37%)
Similarity:216/419 (52%) Gaps:49/419 (12%)


  Fly     8 LTQLLPR-----WVDL-ENVVRGEVEARYILKRAADHLANLRSGGDSGAEETGYLVGALVDRNWE 66
            |..|||.     .:|| |.|.|..|.   :|:||.:.....|......:.|      .::|.:||
Human    60 LRALLPHSKEDLKLDLGEKVERSVVT---LLQRATELFYEGRRDECLQSSE------VILDYSWE 115

  Fly    67 RIHTGHFSQVPLVTRKIYAIACCFKIFFLLLESTSPAQKDACSEILDEAQLLGCMEDWSELKVAL 131
            :::||.:..|....|::|||.|..|...|...........|...:.|...|:|.        ..|
Human   116 KLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAALRVCDMGLLMGA--------AIL 172

  Fly   132 MDYLDKDGAVALNSAP--------LPTLEPLTR-----------VTSNCDIPQLDAPSLEEFQTK 177
            .|.|.|..|:.....|        ||. :|.|:           |.....:|:|..|||:.|:.:
Human   173 GDILLKVAAILQTHLPGKRPARGSLPE-QPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQ 236

  Fly   178 CFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFLSRQ 242
            ....|:|.:|.....|||.:.|| .|.|:.::||.||||:|:||.|..:||||.|:.:.:|:|:.
Human   237 FLVPGRPVILKGVADHWPCMQKW-SLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKY 300

  Fly   243 FGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHY 307
            ...||...|    |||||:||.|||.||:||||||||::.:.:.. .:.|.||.||.||:||:|.
Human   301 IVNEPRDVG----YLAQHQLFDQIPELKQDISIPDYCSLGDGEEE-EITINAWFGPQGTISPLHQ 360

  Fly   308 DPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQ 372
            ||:.|.|.||.|.|.|.|.:|.::..|||||:..|.||:::|....|.|.:|..||..|...:|.
Human   361 DPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILS 425

  Fly   373 PGDCLYMPPKWWHYVRSEAPSFSVSFWW 400
            ||:.|::|.|:|||||:...||||||||
Human   426 PGEILFIPVKYWHYVRALDLSFSVSFWW 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 106/230 (46%)
KDM8NP_001138820.1 Cupin_8 233..454 CDD:290351 106/228 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292021718
eggNOG 1 0.900 E1_KOG2132
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 258 1.000 Inparanoid score I3099
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 1 1.000 FOG0006582
OrthoInspector 1 1.000 T1075279
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3673
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.