DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and tyw5

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001071011.1 Gene:tyw5 ZFINID:ZDB-GENE-060929-894 Length:326 Species:Danio rerio

Alignment Length:278 Identity:69/279 (25%)
Similarity:111/279 (40%) Gaps:74/279 (27%)


  Fly   162 DIPQLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIG------ 220
            ::|.......|.|....:...:|. :|..:...|.:..| .:.:|.:..|:|.|.:.:.      
Zfish     8 EVPVYTDVDKETFLRDIYPQRRPA-VLKRVPIGPCVRTW-TVCFLAEKGGDREVKVHVSPEPRMD 70

  Fly   221 ---SNYA-----SDEWSQQLVKIRD---FLS-------RQFG----KEPSKAGQNIEYLAQHELF 263
               .|:.     .||:.::..:.:.   |:|       |..|    |||:            :|.
Zfish    71 FLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPA------------DLR 123

  Fly   264 AQIPALKEDISIPD-------YCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSK 321
            .|.|.|.||..:|.       :.::....:||   ::.|         .|||...|||.||.|.|
Zfish   124 KQFPELAEDFHVPQFFEPEQFFSSVFRISSPG---LQLW---------THYDVMDNLLAQVTGKK 176

  Fly   322 RIILAAPADTDNLY--PHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWW 384
            |::|.:|.|..:||  ...||.|      |....|.:.||...|.:.|:.:|:|||.|::|..|:
Zfish   177 RVVLYSPEDALHLYLTGDKSEVL------DIDSPDLQLYPEFVKARRYECILEPGDLLFIPALWF 235

  Fly   385 HYVRSEAPSFSVS---FW 399
            |  .:.|..|.|.   ||
Zfish   236 H--NTLALQFGVGVNVFW 251

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 68/269 (25%)
tyw5NP_001071011.1 Cupin_8 18..256 CDD:290351 68/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.