DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and jmjd7

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001011279.1 Gene:jmjd7 XenbaseID:XB-GENE-1000701 Length:313 Species:Xenopus tropicalis

Alignment Length:272 Identity:75/273 (27%)
Similarity:121/273 (44%) Gaps:40/273 (15%)


  Fly   163 IPQLDA-PSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSN-YAS 225
            :|.||| ||..:|........:|.::.|...|||||||| ...||....|::.|.:.:..| ||.
 Frog    28 VPYLDAPPSPLQFHRDWVSPNRPCIIRNAFTHWPALHKW-TFGYLRTHIGSKKVSVAVTPNGYAD 91

  Fly   226 DEWSQQLVK-------IRDFLSRQFGKEPSKAGQNIEYLAQH--ELFAQIPALKEDIS--IPDYC 279
            ..:..:.|.       :.|||. ...|:.:..|  :.|:.:.  .|..:.|.|.||:.  || :.
 Frog    92 AVYKNRFVMPEERTMFLSDFLD-IVEKKSNTPG--VFYIQKQCSNLTEEFPELVEDVENHIP-WM 152

  Fly   280 TISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPAD------------TD 332
            :.:...:|.||:.  |||.:..::.:|.|...||.|.:.|.|..||..|:|            |.
 Frog   153 SETLGKSPDAVNF--WLGESAAITSLHKDHYENLYCVISGEKHFILHPPSDRPFIPYEMFQPATY 215

  Fly   333 NLY--------PHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS 389
            ::|        .|:|........:|..:.|...||...:.|.....::.|:.||:|..|:|:||.
 Frog   216 HVYEDGSFKVVDHESAEKVPWIPLDPLEPDLIRYPSYKQTKPLHCTVRAGEMLYLPSLWFHHVRQ 280

  Fly   390 EAPSFSVSFWWE 401
            .....:|:||::
 Frog   281 SHGCIAVNFWYD 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 69/261 (26%)
jmjd7NP_001011279.1 Cupin_8 37..297 CDD:316171 69/264 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.