DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and kdm8

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001103339.2 Gene:kdm8 ZFINID:ZDB-GENE-040718-411 Length:406 Species:Danio rerio

Alignment Length:375 Identity:139/376 (37%)
Similarity:199/376 (53%) Gaps:61/376 (16%)


  Fly    60 LVDRNWERIHTGHFSQVPLVTRKIYAIACCFKIFFLLLESTSPAQKDACSEILDEA--------- 115
            ::|.:||:::.|.:..|....|::|:..|.||:  |.|...:|.|     .|:.||         
Zfish    58 IIDYSWEKLNIGTWRDVDKEWRRVYSYGCLFKV--LSLCHGNPPQ-----NIIQEAIRTCDMSLL 115

  Fly   116 -----------QLLGCME-----------DWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVT 158
                       :|:|.:.           :|||...:.....|......||    ||.|      
Zfish   116 MGAAIMDNILQRLVGILRNKIKTTSPNKAEWSEEPCSKKRKHDCKSEPVLN----PTKE------ 170

  Fly   159 SNCDIPQLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPAL--HKWLDLNYLLQVAGNRTVPIEIGS 221
                :|::..||||.|::...::.:|.::.....||||.  |.| .::||..|||.||||||:||
Zfish   171 ----VPRIHCPSLERFRSDFLDSKKPVIIEGITDHWPAFTQHPW-SIDYLRTVAGCRTVPIEVGS 230

  Fly   222 NYASDEWSQQLVKIRDFLSRQF-GKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNED 285
            .|..:||||:|:.:.||:.|.. |.|....|    |||||:||.|:|.|||||.|||||.:...|
Zfish   231 KYTDEEWSQKLITVNDFIDRYITGTEEDGVG----YLAQHQLFDQVPELKEDIRIPDYCCLGEGD 291

  Fly   286 TPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDA 350
            ... :.|.||.||.|||||:|.||:.|.|.||.|.|.|.|.:|.:|.:||||:|:.|.||::::.
Zfish   292 EDD-ITINAWFGPGGTVSPLHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEV 355

  Fly   351 AQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 400
            ...|...:|..::..:.:.:|.|||.|::|.:.||||||...||||||||
Zfish   356 ENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 405

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 107/233 (46%)
kdm8NP_001103339.2 Cupin_8 180..406 CDD:290351 107/233 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C292021102
eggNOG 1 0.900 E1_KOG2132
Hieranoid 1 1.000
Homologene 1 1.000 H49791
Inparanoid 1 1.050 233 1.000 Inparanoid score I3325
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 1 1.000 FOG0006582
OrthoInspector 1 1.000 T1054528
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12461
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3673
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.