DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and HSPBAP1

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_651581.2 Gene:HSPBAP1 FlyBaseID:FBgn0263025 Length:398 Species:Drosophila melanogaster

Alignment Length:271 Identity:72/272 (26%)
Similarity:112/272 (41%) Gaps:77/272 (28%)


  Fly   160 NCDIPQLDAPSLEEFQTK--CFEAGQPTLLLNTIQHWPALHKW----------LDLNYLLQVAGN 212
            |..:|.:    ||:|..|  |||.              :||.|          |....|:.:|.:
  Fly    13 NTHVPLV----LEQFPLKWECFEG--------------SLHDWCKRFDKEATCLPAFELMALADS 59

  Fly   213 RTVPIEIGSNYASDEW------SQQLVKIRDFLSRQFGKEPSKAGQNIEYLA-QHELFAQIP-AL 269
            .|           .:|      |.||:.::.|| |::|   ...|.:..:.| |::...::| :.
  Fly    60 ST-----------PQWERKRTKSSQLLNMQQFL-RKYG---VLDGDSTHWAAYQYKKADEVPLSC 109

  Fly   270 KEDI-----SIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDP-KHNLLCQVFGSKRIILAAP 328
            :..|     ..||   |.|       |.:.|||.....:|.|||. ..|::.||.|.|..:|..|
  Fly   110 RSGIGFSSFGFPD---IGN-------DYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPP 164

  Fly   329 ----ADTDNLYPHDSEF-LANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVR 388
                ..|...|...|.: |.|....|.|::  .:|..:.: :.|...||||:.|.:|..|||||.
  Fly   165 ETPLQSTRIPYEETSVYCLENFYAPDPAKI--SSYEHLGR-QAYHCNLQPGNVLIVPRHWWHYVE 226

  Fly   389 SEAPSFSVSFW 399
            :::.|.||::|
  Fly   227 AKSTSLSVNYW 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 69/260 (27%)
HSPBAP1NP_651581.2 cupin_like 11..237 CDD:304367 71/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C63259397
eggNOG 1 0.900 E1_KOG2132
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12461
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.