DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and hif1an

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_958904.1 Gene:hif1an ZFINID:ZDB-GENE-030826-19 Length:344 Species:Danio rerio

Alignment Length:310 Identity:78/311 (25%)
Similarity:126/311 (41%) Gaps:67/311 (22%)


  Fly   136 DKDGAVALNSAPLPTLE--PLTRVTSNCDIPQLDAPSLEEFQTKC---FEAGQPTLLLNTIQHWP 195
            :.|||.|......|..:  .|.:.|    .|....|.|.....:.   ....:|.:|.:|...:|
Zfish     3 ETDGAAAFTELRDPGWDGSQLRQYT----FPTRQIPRLSHTDPRAEVLINNEEPVVLTDTSLVYP 63

  Fly   196 ALHKWLDLNYLLQVAGNRTVPIEIGSNYA---SDEWSQQLVKIRDFLSR------QFGKEPSKAG 251
            || || |:.||.:..||....:.|..|:.   .||  :::|..:||:.:      :|.:...|..
Zfish    64 AL-KW-DIPYLQENIGNGDFSVYIAENHKFLYYDE--KKMVNFQDFVPKSRRIEMKFSEFVDKMH 124

  Fly   252 QNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPG---AVDI--------------KAW---- 295
            |..|...:..::.|             .|::  ||.|   .||.              :.|    
Zfish   125 QTEEQGGKGRVYLQ-------------QTLN--DTVGRKIVVDFLGFNWNWINKQQAKRNWGPLT 174

  Fly   296 -----LGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLAN-TARIDAAQLD 354
                 :|..|.|:|.|||.:.|...|:.|.||.||..|...|.|||:......: .:::|....|
Zfish   175 SNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPEQFDCLYPYPVHHPCDRQSQVDFENPD 239

  Fly   355 PETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS---EAPSFSVSFWWE 401
            .:.:|.......|:.::.|||.||:|..|||::.|   ...:.:|:||::
Zfish   240 YDKFPNFKNAVGYEAVVGPGDVLYIPMYWWHHIESLLNGGETITVNFWYK 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 68/271 (25%)
hif1anNP_958904.1 Cupin_8 51..288 CDD:290351 68/256 (27%)
Substrate binding. {ECO:0000250|UniProtKB:Q9NWT6} 173..174 0/1 (0%)
Substrate binding. {ECO:0000250|UniProtKB:Q9NWT6} 192..194 1/2 (50%)
Substrate binding. {ECO:0000250|UniProtKB:Q9NWT6} 229..230 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.