DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: JMJD5 and Hif1an

Sequence 1:NP_612063.2 Gene:JMJD5 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_795932.2 Gene:Hif1an MGIID:2442345 Length:349 Species:Mus musculus

Alignment Length:327 Identity:85/328 (26%)
Similarity:136/328 (41%) Gaps:78/328 (24%)


  Fly   110 EILDEAQLLGCMEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDIPQLDAPSLEEF 174
            |..:||:..|...|.|:|:                |...|| .|:.|::      |.| |..||.
Mouse    15 EAREEAEAPGPAWDESQLR----------------SYSFPT-RPIPRLS------QSD-PRAEEL 55

  Fly   175 QTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIRDFL 239
                .|..:|.:|.:|...:||| || ||.||.:..||....:...|.:....:.::  |:.:| 
Mouse    56 ----IENEEPVVLTDTNLVYPAL-KW-DLEYLQENIGNGDFSVYSASTHKFLYYDEK--KMGNF- 111

  Fly   240 SRQFGKEPSKAGQNIEYLAQHELFAQIPAL-----KEDISIPDYCTISNEDTPG---AVDI---- 292
                  :..|...|.|.:..||...::.|:     :|.:    |...:..||.|   .:|.    
Mouse   112 ------QNFKPRSNREEIKFHEFVEKLQAIQQRGGEERL----YLQQTLNDTVGRKIVMDFLGFN 166

  Fly   293 ----------KAW---------LGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHD 338
                      :.|         :|..|.|:|.|||.:.|...|:.|.||.||..|...:.|||:.
Mouse   167 WNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFECLYPYP 231

  Fly   339 SEFLAN-TARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS---EAPSFSVSFW 399
            .....: .:::|....|.|.:|....|..|:.::.|||.||:|..|||::.|   ...:.:|:||
Mouse   232 VHHPCDRQSQVDFDNPDYERFPNFRNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFW 296

  Fly   400 WE 401
            ::
Mouse   297 YK 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 70/264 (27%)
Hif1anNP_795932.2 Interaction with VHL. {ECO:0000250} 2..125 38/149 (26%)
Cupin_8 53..297 CDD:290351 70/263 (27%)
Substrate binding. {ECO:0000250} 181..183 0/2 (0%)
Substrate binding. {ECO:0000250} 201..203 1/2 (50%)
Substrate binding. {ECO:0000250} 238..239 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.